Recombinant Prosthecochloris aestuarii NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Paes_0842; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Target Names
nuoA
Target Protein Sequence
MDQTLSDFGAVFVFLLLGTVFVVGGYLTARLLRPSRPNPEKLAVYECGEDAVGTSWVKFN IRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALIEALVFAGILIIGLAYAWVKGDLDW VRPTPNIPSMPQPPQKEK
Uniprot No.

Target Background

Function
NDH-1 functions as an electron shuttle, transferring electrons from NADH to quinones within the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, the primary electron acceptor is believed to be a menaquinone. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) and what is its role in Prosthecochloris aestuarii?

NADH-quinone oxidoreductase subunit A (nuoA) is a small membrane-spanning subunit of respiratory chain complex I. It serves as a core protein component of the electron transport chain in Prosthecochloris aestuarii, a green sulfur bacterium. Unlike other complex I core protein subunits, nuoA has no known homologues in other enzyme systems, making it unique to complex I functionality . The protein consists of 138 amino acids and plays an essential role in the bioenergetic processes of this photosynthetic bacterium. As part of the NADH dehydrogenase complex, nuoA contributes to electron transfer and energy conservation mechanisms that support the organism's anaerobic lifestyle .

How does nuoA differ from homologous proteins in other bacterial species?

The transmembrane orientation of nuoA cannot be unambiguously predicted due to its small size and the varying distribution of charged amino acid residues across different bacterial species . Research on the Escherichia coli complex I has demonstrated that its nuoA has the C-terminal end localized in the bacterial cytoplasm, which contrasts with previous reports for the homologous NQO7 subunit from Paracoccus denitrificans complex I . This structural difference highlights species-specific variations in membrane protein orientation that may reflect adaptations to different ecological niches. Prosthecochloris aestuarii, as a strict anaerobe and green sulfur bacterium, likely exhibits unique structural characteristics in its nuoA protein that are adapted to its photosynthetic lifestyle and the low-light, sulfide-rich environments it typically inhabits .

What is the predicted membrane topology of nuoA in Prosthecochloris aestuarii?

The membrane topology of nuoA in Prosthecochloris aestuarii remains challenging to predict with absolute certainty due to its small size and the variable distribution of charged amino acid residues . Based on comparative analyses with homologous proteins like the E. coli nuoA, where the C-terminal end localizes to the bacterial cytoplasm, it's reasonable to hypothesize a similar orientation in P. aestuarii .

What post-translational modifications have been identified in Prosthecochloris aestuarii nuoA?

In bacterial respiratory complexes, common PTMs include phosphorylation, acetylation, and various redox-based modifications that can regulate protein function in response to changing metabolic conditions. The presence of cysteine residues in the nuoA sequence (as indicated in the amino acid sequence) provides potential sites for redox-based modifications such as disulfide bond formation or glutathionylation, which could play regulatory roles in the anaerobic environment where P. aestuarii thrives .

Future proteomic studies employing mass spectrometry-based approaches would be valuable for comprehensive characterization of PTMs in native nuoA from P. aestuarii and for understanding how these modifications might influence protein function and complex assembly.

What expression systems are most effective for producing recombinant Prosthecochloris aestuarii nuoA protein?

The most well-documented expression system for recombinant Prosthecochloris aestuarii nuoA protein utilizes Escherichia coli with an N-terminal His-tag . This approach has successfully yielded purified protein with greater than 90% purity as determined by SDS-PAGE analysis. The expression construct incorporates the full-length nuoA sequence (amino acids 1-138) fused to a His-tag at the N-terminus, which facilitates subsequent purification using affinity chromatography .

While E. coli remains the preferred heterologous expression host for many bacterial membrane proteins, researchers should consider several parameters when optimizing expression:

  • E. coli strain selection: BL21(DE3) and its derivatives are commonly used for membrane protein expression due to their reduced protease activity.

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often improve the yield of properly folded membrane proteins.

  • Membrane extraction: Efficient solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) is critical for maintaining protein structure during purification.

  • Alternative tags: While His-tags are standard, alternative fusion systems such as maltose-binding protein (MBP) or glutathione S-transferase (GST) may improve solubility for difficult-to-express constructs.

For studies requiring native-like membrane environments, expression in membrane-mimetic systems or reconstitution into nanodiscs or liposomes post-purification should be considered to preserve functional characteristics .

What are the optimal storage and reconstitution conditions for purified recombinant nuoA protein?

Based on established protocols, the following storage and reconstitution conditions are recommended for purified recombinant nuoA protein:

Storage Conditions:

  • Store lyophilized protein powder at -20°C to -80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 5-50% (preferably 50%)

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for preparations intended for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose, pH 8.0

It's important to note that repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity. For functional studies, reconstitution into membrane mimetics may be necessary to maintain the protein's native conformation and activity.

What analytical techniques are most useful for studying the membrane topology of nuoA?

Several complementary analytical techniques have proven valuable for elucidating the membrane topology of small membrane proteins like nuoA:

  • Fusion protein approaches: Creating fusion constructs with reporter proteins such as alkaline phosphatase or cytochrome c has been successfully employed to determine the orientation of nuoA termini relative to the membrane. This technique was instrumental in revising the transmembrane orientation of E. coli nuoA, showing that its C-terminal end localizes to the bacterial cytoplasm .

  • Cysteine scanning mutagenesis: This approach involves introducing cysteine residues at various positions throughout the protein sequence, followed by accessibility studies using membrane-permeable and membrane-impermeable sulfhydryl reagents to map regions exposed to different cellular compartments.

  • Protease protection assays: Limited proteolysis of membrane-embedded proteins followed by mass spectrometry analysis can identify accessible regions and help establish membrane topology.

  • Computational prediction: While not definitive, hydropathy analysis and specialized algorithms like TMHMM, MEMSAT, and TOPCONS provide initial topology predictions that can guide experimental design.

  • Cryo-electron microscopy: Advanced structural biology techniques, particularly cryo-EM, have revolutionized our understanding of membrane protein complexes, though resolution limitations may still apply for small subunits like nuoA.

For comprehensive topology mapping, researchers should employ multiple complementary techniques rather than relying on a single approach, particularly given the challenges associated with small membrane proteins like nuoA where traditional prediction methods can be ambiguous .

How does nuoA interact with other subunits in the NADH:quinone oxidoreductase complex of Prosthecochloris aestuarii?

In bacterial complex I, nuoA typically interacts closely with other membrane domain subunits, particularly nuoH, nuoJ, and nuoK. These interactions form part of the proton translocation machinery that couples electron transfer to proton pumping across the membrane. The revised C-terminal cytoplasmic orientation of nuoA in E. coli suggests that this region may participate in interactions with matrix-facing subunits or peripheral components of the complex .

Future research utilizing techniques such as chemical cross-linking followed by mass spectrometry, hydrogen-deuterium exchange, or high-resolution cryo-electron microscopy would be valuable for mapping the precise interaction network of nuoA within the context of the entire P. aestuarii complex I. Understanding these interactions is crucial for elucidating the mechanism of energy conversion in this photosynthetic bacterium.

What metabolic adaptations in Prosthecochloris aestuarii might influence nuoA function under different environmental conditions?

Prosthecochloris aestuarii exhibits remarkable metabolic adaptations to different environmental conditions, particularly in response to varying light intensities and oxygen/sulfide gradients, which likely influence the function of respiratory proteins including nuoA .

Light-Dependent Adaptations:
P. aestuarii shows significant morphological and ultrastructural changes in response to light intensity, with altered cell shape, prosthecae length, and pigment composition . These adaptations suggest coordinated regulation of energy metabolism pathways. Under low light conditions, the bacterium optimizes its light-harvesting capacity, potentially increasing reliance on efficient respiratory electron transport chains involving nuoA for energy conservation.

Anaerobic Metabolism:
As a strict anaerobe, P. aestuarii thrives in oxygen-depleted, sulfide-rich environments . The NADH:quinone oxidoreductase complex containing nuoA likely plays a crucial role in maintaining redox balance under these conditions. Studies of mixed biofilms containing P. aestuarii demonstrate that its metabolism is highly dependent on the absence of oxygen and the presence of sulfide as an electron donor for photosynthesis .

Interactions with Other Organisms:
In environmental settings, P. aestuarii can benefit from the oxygen-scavenging activities of other bacterial species (e.g., Thiocapsa roseopersicina), which create more favorable anaerobic microenvironments . These ecological interactions may indirectly regulate nuoA function by modifying the redox environment in which the protein operates.

Future research integrating transcriptomics, proteomics, and metabolomics approaches would provide valuable insights into how environmental factors modulate the expression and activity of respiratory chain components like nuoA in this ecologically important bacterium.

What experimental design approaches are most effective for studying the functional role of nuoA in energy metabolism?

Investigating the functional role of nuoA in energy metabolism requires systematic experimental approaches that address both molecular mechanisms and physiological significance. The following experimental design strategies are recommended:

These experimental approaches should be implemented with careful consideration of P. aestuarii's strict anaerobic nature and light-dependent metabolism to ensure physiologically relevant conditions are maintained throughout the investigation .

What are the key physical and biochemical properties of recombinant Prosthecochloris aestuarii nuoA protein?

The following table summarizes the essential properties of recombinant Prosthecochloris aestuarii NADH-quinone oxidoreductase subunit A (nuoA) protein:

PropertyValueSource
Amino Acid Length138 amino acids
Molecular WeightApproximately 15 kDa (estimated from sequence)
UniProt IDB4S751
Gene SynonymsnuoA; Paes_0842; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Expression SystemE. coli
Fusion TagN-terminal His tag
Purity>90% (SDS-PAGE)
Storage FormLyophilized powder
Optimal pHpH 8.0 (storage buffer)
C-terminal OrientationLikely cytoplasmic (based on E. coli homolog)

This data compilation represents the currently available information from published sources. The biochemical properties provide a foundation for experimental design when working with this protein.

How does the growth environment affect Prosthecochloris aestuarii morphology and potentially nuoA expression?

The following table summarizes the documented effects of light intensity on Prosthecochloris aestuarii morphology and physiological parameters, which may correlate with changes in respiratory protein expression:

ParameterLow Light (0.5 μmol quanta m⁻² s⁻¹)Medium Light (5 μmol quanta m⁻² s⁻¹)High Light (100 μmol quanta m⁻² s⁻¹)Source
Cell MorphologyStar-likeStar-likeMore rod-shaped
Prosthecae Length232 nm194 nm98 nm
Cell Perimeter to Area RatioHighIntermediateSignificantly lower
Chlorosomes per μm of MembraneHighIntermediateReduced
Specific Pigment ContentHigherHigherLower
Pigment Synthesis RatesHigherHigherLower
BChl c Q(y) Absorption Maximum ShiftMinimalIntermediateUp to 17.5 nm blue shift
Carotenoid ContentHigherIntermediateVery low

These morphological and physiological adaptations demonstrate P. aestuarii's remarkable capacity to respond to different light environments. While direct measurements of nuoA expression under these conditions are not available in the current literature, these adaptations suggest coordinated regulation of energy metabolism components, likely including respiratory chain complexes containing nuoA .

What emerging technologies might advance our understanding of nuoA function in Prosthecochloris aestuarii?

Several cutting-edge technologies hold promise for elucidating the structure, function, and regulation of nuoA in Prosthecochloris aestuarii:

  • Cryo-Electron Tomography: This technique allows visualization of protein complexes in their native cellular environment without the need for protein purification, potentially revealing the precise localization and organization of nuoA within the membrane architecture of P. aestuarii.

  • Single-Molecule FRET: Applying fluorescence resonance energy transfer at the single-molecule level could provide insights into conformational changes in nuoA during the catalytic cycle of NADH:quinone oxidoreductase, elucidating its role in energy transduction.

  • CRISPR-Cas9 Genome Editing: Developing efficient genetic manipulation tools for P. aestuarii would enable precise editing of the nuoA gene to investigate structure-function relationships through targeted mutations or domain swapping experiments.

  • Nanopore Sequencing: Direct RNA sequencing using nanopore technology could reveal transcriptional regulation of nuoA under different environmental conditions with single-molecule resolution, potentially identifying novel regulatory mechanisms.

  • Artificial Intelligence for Structural Prediction: Leveraging AI-based tools like AlphaFold2 could generate high-confidence structural models of nuoA and its interactions within complex I, guiding experimental design and hypothesis generation .

These technologies, combined with optimal experimental design approaches, will enable researchers to address fundamental questions about nuoA's role in the bioenergetics of this environmentally important photosynthetic bacterium .

How might comparative studies between different bacterial species enhance our understanding of nuoA evolution?

Comparative studies across diverse bacterial species represent a powerful approach to understanding the evolution and functional conservation of nuoA:

  • Phylogenetic Analysis: Comprehensive phylogenetic studies incorporating nuoA sequences from diverse bacterial phyla, including green sulfur bacteria like P. aestuarii, purple bacteria, cyanobacteria, and non-photosynthetic bacteria, would reveal evolutionary relationships and potential adaptive changes associated with different metabolic lifestyles.

  • Structure-Function Comparisons: The documented differences in membrane topology between E. coli nuoA and P. denitrificans NQO7 highlight the importance of comparative functional studies . Extending these analyses to include P. aestuarii nuoA could reveal how structural variations relate to functional adaptations in different ecological niches.

  • Horizontal Gene Transfer Assessment: Analyzing genomic contexts of nuoA across species could identify instances of horizontal gene transfer that might have contributed to the acquisition of complex I components in different bacterial lineages.

  • Coevolution with Photosynthetic Apparatus: In photosynthetic bacteria like P. aestuarii, investigating potential coevolution between nuoA and components of the photosynthetic apparatus could reveal insights into the integration of respiratory and photosynthetic electron transport chains.

  • Environmental Adaptation Signatures: Comparing nuoA sequences from bacteria inhabiting different environments (e.g., anaerobic vs. aerobic, marine vs. terrestrial) could identify adaptive signatures associated with specific ecological challenges.

These comparative approaches would not only enhance our understanding of nuoA evolution but also provide insights into the broader question of how respiratory complexes have adapted to diverse metabolic strategies across the bacterial domain .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.