Recombinant Prosthecochloris aestuarii Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
htpX; Paes_0986; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Target Names
htpX
Target Protein Sequence
MKRIVLFLLTNFAVILVLSISARLLGVDRFLTSNGLNMGMLLAFAALIGFGGSFISLMMS KTMAKWSTGARVIERPGNQDEAWLMDTVRQLSKKAGFPMPEVAVFDGAPNAFATGPSKSK SLVAVSTGLLQSMNRKEVEAVLAHEVAHIQNGDMVTLTLIQGVVNTFVIFLARALAYVVD NFLRGDEKESSGPGIGYWVSSIAFEIMFGILASIVVMFFSRKREYRADAGAAALMGERRS MIDALRVLGGLEAGALPKEMAASGIAGGGMMALFSSHPPIEARIAALESAR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prosthecochloris aestuarii Protease HtpX homolog and how is it classified?

Prosthecochloris aestuarii Protease HtpX homolog (htpX) is a member of the M48 family of zinc metalloproteinases. The protein is encoded by the htpX gene (locus name: Paes_0986) in Prosthecochloris aestuarii (strain DSM 271/SK 413). Based on homology with other bacterial HtpX proteins, particularly in Escherichia coli, it is likely involved in the quality control of membrane proteins . Its UniProt accession number is B4S7I8, and it functions as an integral membrane protein with proteolytic activity .

How does HtpX function as a membrane protease?

Based on studies of HtpX homologs, particularly in E. coli, the protein functions as a membrane-embedded zinc metalloproteinase involved in protein quality control. It is believed to recognize and cleave misfolded or damaged membrane proteins, thereby contributing to membrane protein homeostasis . The enzymatic classification (EC 3.4.24.-) indicates it belongs to the metalloendopeptidases that cleave internal peptide bonds in proteins and peptides . The active site likely contains a zinc ion coordinated by conserved histidine residues, which is characteristic of this protease family .

What are the optimal storage and handling conditions for recombinant Prosthecochloris aestuarii HtpX?

For optimal preservation of enzymatic activity, the recombinant Prosthecochloris aestuarii Protease HtpX homolog should be stored in a Tris-based buffer containing 50% glycerol. The recommended storage temperature is -20°C for regular use, or -80°C for extended storage periods .

Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles. It is important to note that repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of enzymatic activity . For experimental work, creating single-use aliquots is recommended to preserve protein stability and activity.

How can researchers establish an in vivo assay system for studying HtpX proteolytic activity?

Based on methodologies developed for E. coli HtpX, researchers can establish an in vivo proteolytic activity assay for Prosthecochloris aestuarii HtpX by:

  • Creating model substrates specifically designed for HtpX recognition

  • Implementing a semiquantitative detection system for proteolytic cleavage products

  • Incorporating appropriate controls including active site mutants

A particularly effective approach involves constructing fusion proteins that contain recognition sequences for HtpX and reporter elements (such as GFP or other tags) that enable detection of proteolytic activity . This system allows researchers to:

  • Detect differential protease activities among HtpX variants

  • Study the effects of mutations in conserved regions

  • Investigate structure-function relationships

  • Test potential inhibitors or activators of HtpX activity

The detection of cleavage products can be accomplished through techniques such as Western blotting or fluorescence-based assays .

What expression systems are suitable for producing functional recombinant Prosthecochloris aestuarii HtpX?

Although the search results don't provide specific information about expression systems for Prosthecochloris aestuarii HtpX, general principles for membrane protein expression can be applied. Based on knowledge about similar membrane proteases:

  • E. coli-based systems: May be suitable with careful optimization of expression conditions to prevent toxicity issues common with membrane proteases.

  • Specialized membrane protein expression systems: These might include C41/C43 E. coli strains or Lemo21(DE3) that are designed for toxic membrane protein expression.

  • Cell-free systems: These can be advantageous for membrane proteases as they allow precise control over the expression environment.

The choice of purification tags should be carefully considered, as the search results indicate that "the tag type will be determined during production process" , suggesting that optimal tag configuration may vary depending on specific experimental requirements.

How can mutagenesis studies be designed to investigate structure-function relationships in HtpX?

To investigate structure-function relationships in Prosthecochloris aestuarii HtpX, researchers can employ targeted mutagenesis approaches focusing on:

  • Conserved catalytic residues: Mutating potential zinc-binding motifs and catalytic residues to evaluate their importance for proteolytic activity.

  • Transmembrane domains: Systematic alterations of the putative membrane-spanning regions to understand their role in substrate recognition and membrane integration.

  • Substrate binding regions: Creating chimeric proteins with homologous proteases to identify regions responsible for substrate specificity.

The effectiveness of these mutations can be evaluated using the in vivo protease activity assay system similar to that developed for E. coli HtpX, which enables "detection of differential protease activities of HtpX mutants carrying mutations in conserved regions" .

What are the challenges in identifying physiological substrates of Prosthecochloris aestuarii HtpX?

Identifying physiological substrates of membrane proteases like HtpX presents several significant challenges:

  • Membrane environment complexity: The hydrophobic nature of potential substrates makes traditional protein-protein interaction studies difficult.

  • Transient interactions: Enzyme-substrate interactions for proteases are often transient and challenging to capture.

  • Substrate validation: Confirming that potential substrates identified in vitro are actually processed in vivo requires careful experimental design.

As noted for E. coli HtpX, "its in vivo proteolytic function has not been characterized in detail, mainly because the physiological substrates have not been identified" . This indicates that substrate identification remains a major challenge across HtpX homologs from different species.

A potential approach to overcome these challenges is to use techniques such as:

  • Proteomic profiling comparing wild-type and htpX deletion strains

  • Cross-linking coupled with mass spectrometry

  • Substrate trapping using catalytically inactive mutants

How does HtpX integrate into the broader quality control network for membrane proteins?

Based on studies of HtpX homologs, particularly in E. coli, this protease likely functions as part of a broader membrane protein quality control network. E. coli HtpX "is suggested to be involved in proteolytic quality control of cytoplasmic membrane proteins" . The integration of HtpX in this network likely involves:

  • Cooperation with other proteases: Potential functional overlap or cooperation with other membrane-associated proteases.

  • Stress response integration: Activation or regulation in response to membrane protein misfolding stresses.

  • Recognition mechanisms: Specific recognition of damaged or misfolded membrane proteins versus normal ones.

Research investigating these aspects could involve studying genetic interactions between htpX and other genes involved in membrane protein biogenesis and quality control, as well as examining how environmental stresses affect HtpX activity and expression.

What functional differences exist between HtpX homologs across bacterial species?

While the search results primarily focus on Prosthecochloris aestuarii HtpX and briefly mention E. coli HtpX, researchers should consider comparative analysis across species. The basic function of HtpX appears to be conserved as a membrane protease involved in protein quality control , but specific adaptations may exist related to:

  • Substrate specificity: Different bacterial species may have evolved specific substrate preferences based on their membrane protein composition.

  • Regulatory mechanisms: The expression and activity regulation of HtpX may vary across species depending on their ecological niches and stress responses.

  • Structural variations: While core catalytic domains are likely conserved, membrane topology and substrate-binding regions may show adaptation.

Evolutionary analysis of HtpX across diverse bacterial lineages could provide insights into the coevolution of this protease with its substrates and regulatory partners.

How can researchers develop improved model substrates for studying HtpX activity?

Developing effective model substrates is crucial for studying HtpX activity. Based on the approach described for E. coli HtpX, where researchers "constructed a new model substrate of HtpX and established an in vivo semiquantitative and convenient protease activity assay system" , researchers working with Prosthecochloris aestuarii HtpX could:

  • Analyze substrate requirements: Identify potential cleavage site motifs based on known or predicted substrates.

  • Design fusion constructs: Create chimeric proteins containing potential cleavage sites and detectable reporters.

  • Optimize detection methods: Develop sensitive methods for detecting substrate cleavage, such as:

Detection MethodAdvantagesLimitations
Fluorescence-basedReal-time monitoring, high sensitivityPotential interference from cellular background
Western blotDirect visualization of cleavage productsLabor-intensive, semi-quantitative
Mass spectrometryPrecise identification of cleavage sitesRequires specialized equipment, complex analysis

The design should incorporate controls to distinguish HtpX-specific cleavage from processing by other cellular proteases.

What strategies can improve the expression and purification of functional Prosthecochloris aestuarii HtpX?

Membrane proteases like HtpX present unique challenges for expression and purification. Based on general principles for membrane protein biochemistry and the specific information about recombinant Prosthecochloris aestuarii HtpX , researchers should consider:

  • Expression optimization:

    • Temperature modulation (typically lower temperatures)

    • Inducer concentration optimization

    • Co-expression with chaperones

    • Use of specialized expression hosts

  • Solubilization strategies:

    • Selection of appropriate detergents

    • Amphipol or nanodisc reconstitution for native-like environment

    • Lipid composition optimization

  • Purification considerations:

    • Two-step purification process to enhance purity

    • Affinity chromatography followed by size exclusion

    • Activity preservation during purification

The recombinant protein is optimally stored in "Tris-based buffer, 50% glycerol, optimized for this protein" , suggesting that buffer composition is critical for maintaining stability and activity.

How can researchers accurately measure HtpX enzyme kinetics?

Measuring enzyme kinetics for membrane proteases presents unique challenges due to their hydrophobic nature and membrane association. Based on methodologies used for similar proteases, researchers could:

  • Develop a quantitative assay system: Building upon the semiquantitative in vivo assay described for E. coli HtpX , researchers should establish systems that provide precise quantification of proteolytic activity.

  • Consider the following approaches:

ParameterMeasurement ApproachConsiderations
kcatQuantification of product formation over time using purified enzymeRequires pure, active enzyme and quantifiable substrate/product
KmSubstrate concentration seriesMay require detergent solubilization that could affect binding
Inhibition constantsActivity in presence of varying inhibitor concentrationsImportant for characterizing specificity
  • Account for membrane environment: Native membrane environment significantly affects protease activity, so reconstitution in liposomes or nanodiscs may provide more physiologically relevant measurements than detergent-solubilized systems.

What emerging technologies could advance the study of HtpX and its role in membrane protein quality control?

Several cutting-edge technologies hold promise for advancing our understanding of HtpX function:

  • Cryo-electron microscopy: Could reveal the three-dimensional structure of HtpX in its membrane environment, providing insights into substrate recognition and catalytic mechanism.

  • Proximity labeling approaches: Methods like BioID or APEX2 could identify proteins in close proximity to HtpX in living cells, helping to map its interaction network.

  • Single-molecule techniques: Could reveal the dynamics of HtpX activity and substrate processing in real-time.

  • Synthetic biology approaches: Engineering artificial membrane protein quality control systems to dissect the specific role of HtpX.

These technologies would complement the existing assay systems, such as the one developed for E. coli HtpX that "enables detection of differential protease activities of HtpX mutants carrying mutations in conserved regions" .

How might understanding HtpX function contribute to broader applications in biotechnology?

Understanding the function of membrane proteases like HtpX has potential applications in several areas:

  • Protein production technology: Improved membrane protein expression systems through better quality control mechanisms.

  • Synthetic biology: Engineered proteolytic systems for specific applications in cellular engineering.

  • Antimicrobial development: If HtpX proves essential for certain pathogens, it could represent a novel target for antimicrobial development.

Further research into the mechanisms of HtpX function, particularly how it recognizes and processes substrates, could inform these applications and provide new tools for biotechnology and biomedicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.