Recombinant Prosthecochloris aestuarii Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; Paes_0191; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Target Names
crcB
Target Protein Sequence
MQERFSAVLLVGAGGFAGASARYLIAVALSSFATGFPMATMLVNVLGCFLIGMISELSLT TSLLPSELRLLLATGFCGGFTTFSSYMYEISALLKDGELFYASLYLIGSLVGGMVFLYLG MALARVWS
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant Prosthecochloris aestuarii CrcB homolog production?

Multiple expression systems have been developed for the production of recombinant Prosthecochloris aestuarii proteins, with varying efficacy depending on research requirements. The selection of an appropriate expression system should be based on experimental needs, including protein folding requirements and downstream applications.

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, rapid growth, economical, suitable for biotinylation via AviTag-BirA technologyMay have improper folding of membrane proteins, potential endotoxin contaminationInitial characterization, structural studies with proper solubilization
YeastBetter for membrane proteins, post-translational modificationsLower yield than E. coli, longer expression timeFunctional studies requiring proper membrane insertion
BaculovirusSuperior for complex membrane proteins, proper foldingMore complex methodology, higher costAdvanced functional studies, protein-protein interactions
Mammalian cellMost native-like post-translational modificationsHighest cost, lowest yield, technically demandingStudies requiring mammalian-like modifications

For membrane proteins like CrcB homologs, E. coli systems using specialized strains (C41, C43) with biotinylation capacity have shown promising results, particularly when combined with detergent optimization for solubilization of correctly folded protein.

How can I confirm the proper folding and functionality of recombinant CrcB homolog?

Confirming proper folding of membrane proteins like CrcB homolog requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy to analyze secondary structure content

  • Fluorescence-based thermal shift assays to assess stability

  • Size exclusion chromatography to verify monodispersity

  • Functional assays measuring fluoride ion transport capacity using liposomes

  • Binding assays with known interaction partners

For functional verification, reconstitution into liposomes followed by ion transport assays using fluoride-sensitive probes represents the gold standard for CrcB proteins, which function as fluoride channels in bacterial membranes.

How does the structure-function relationship of CrcB homolog in P. aestuarii compare to other green sulfur bacteria?

Comparative genomic analysis between coral-associated Prosthecochloris (CAP) and non-CAP clades has revealed specialized adaptations in membrane protein functionality. The CrcB homolog in P. aestuarii likely exhibits structural modifications that contribute to its adaptation to specific ecological niches.

While the exact structure of P. aestuarii CrcB has not been fully resolved, research on related green sulfur bacteria suggests that these proteins contain:

  • Multiple transmembrane domains forming a channel-like structure

  • Conserved fluoride ion coordination sites

  • Species-specific modifications in loop regions correlating with habitat adaptation

Prosthecochloris species found in marine environments, particularly those associated with coral skeletons, demonstrate specialized adaptations in membrane protein composition and function that may extend to the CrcB homolog . These adaptations likely enable survival in microenvironments with fluctuating ion concentrations.

What experimental designs are most appropriate for studying the role of CrcB homolog in fluoride resistance in P. aestuarii?

  • True Experimental Designs: Pretest-Posttest Control Group Design or Solomon Four-Group Design for maximum internal and external validity .

Design TypeStructureAdvantagesControls For
Pretest-Posttest Control GroupR O X O
R O   O
High internal validityHistory, maturation, testing, instrumentation effects
Solomon Four-GroupR O X O
R O   O
R   X O
R     O
Controls for pretest sensitizationAll above plus testing × treatment interaction

Where R = random assignment, O = observation, X = treatment (e.g., fluoride exposure)

  • Gene knockout/complementation approaches: These are essential for establishing causality between CrcB function and fluoride resistance.

  • Dose-response experiments: Testing fluoride resistance across concentration gradients in wild-type vs. CrcB-modified strains.

When designing these experiments, researchers should be cautious of selection bias, interactive effects, and reactive arrangements that might compromise generalizability of findings .

How do environmental factors affect the expression and function of CrcB homolog in different P. aestuarii strains?

Environmental regulation of CrcB expression in P. aestuarii appears to be coordinated with its habitat adaptation mechanisms. Comparative genomic analysis has revealed that coral-associated Prosthecochloris (CAP) possess specialized metabolic capacities and adaptation mechanisms that likely influence membrane protein expression patterns .

Key environmental factors affecting CrcB expression include:

  • Sulfide concentration gradients

  • Light availability and quality

  • pH fluctuations

  • Marine salinity variations

  • Interactions with coral host-derived compounds

Research on related green sulfur bacteria suggests that CrcB expression is upregulated under conditions of elevated environmental fluoride, but this regulation may be integrated with other stress response pathways in P. aestuarii. The presence of gas vesicles in CAP genomes, enabling vertical migration within coral skeletons, suggests sophisticated environmental sensing mechanisms that may include ion homeostasis systems like CrcB .

What purification strategies maximize yield and stability of recombinant P. aestuarii CrcB homolog?

Purification of membrane proteins like CrcB presents significant challenges requiring careful optimization. Based on successful approaches with similar proteins:

Purification StageRecommended MethodCritical ParametersCommon Pitfalls
Cell lysisMechanical disruption (French press or sonication)Buffer pH 7.5-8.0, presence of protease inhibitorsExcessive heating during sonication
Membrane isolationDifferential ultracentrifugationSucrose gradient optimizationIncomplete separation from cytosolic proteins
SolubilizationDetergent screening (DDM, LMNG, or amphipols)Detergent:protein ratio, temperatureProtein denaturation, aggregation
Affinity purificationIMAC via His-tag or biotinylated Avi-tagImidazole concentration gradient, flow rateNon-specific binding, tag interference
Size exclusionSuperdex 200 or equivalentBuffer composition, protein concentrationDilution below detection limits

For CrcB homologs specifically, maintaining stability throughout purification requires careful attention to detergent selection. A two-stage approach using harsher detergents for initial extraction followed by exchange to milder detergents for functional studies has shown success with similar membrane proteins. The biotinylation approach using AviTag-BirA technology offers advantages for downstream applications requiring protein immobilization .

What spectroscopic techniques are most informative for studying CrcB homolog interactions with photosynthetic complexes?

Given the photosynthetic nature of P. aestuarii, potential interactions between CrcB homolog and photosynthetic apparatus may be physiologically relevant. Several spectroscopic techniques have proven valuable for investigating such interactions:

  • Förster Resonance Energy Transfer (FRET): For measuring proximity between labeled CrcB and photosynthetic complexes like the FMO protein

  • Circular Dichroism (CD) Spectroscopy: To detect conformational changes upon interaction

  • Surface Plasmon Resonance (SPR): For quantifying binding kinetics and affinity

  • Fluorescence Correlation Spectroscopy (FCS): To study diffusion properties in membrane environments

Studies of photosynthetic complexes in green sulfur bacteria have revealed sophisticated energy transfer mechanisms . While direct evidence for CrcB interaction with these complexes is limited, their co-localization in membranes suggests potential functional relationships that may impact ion homeostasis during photosynthesis.

How can cryo-EM be optimized for structural determination of P. aestuarii CrcB homolog?

Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology, offering advantages for challenging targets like CrcB. Optimization strategies include:

  • Sample preparation:

    • Screening multiple detergents and amphipathic agents

    • Reconstitution into nanodiscs with various lipid compositions

    • Optimization of protein concentration (typically 0.5-5 mg/mL)

  • Vitrification conditions:

    • Blotting time optimization (typically 3-7 seconds)

    • Grid type selection (Quantifoil R1.2/1.3 or UltrAuFoil)

    • Addition of surfactants to prevent protein aggregation at the air-water interface

  • Data collection parameters:

    • Defocus range determination

    • Exposure rate optimization to balance signal and radiation damage

    • Frame alignment strategies

  • Computational processing:

    • Reference-free 2D classification for initial quality assessment

    • Ab initio 3D model generation

    • Focused refinement of transmembrane regions

The relatively small size of CrcB homologs (typically <30 kDa per monomer) presents challenges for cryo-EM analysis. Strategies such as antibody fragment binding or fusion to larger protein partners may enhance particle visualization and orientation determination.

What bioinformatic approaches reveal evolutionary insights into CrcB homolog adaptation in diverse green sulfur bacteria environments?

Evolutionary analysis of CrcB homologs across green sulfur bacteria provides insights into adaptation mechanisms for different ecological niches:

  • Sequence-based approaches:

    • Multiple sequence alignment of CrcB homologs from diverse green sulfur bacteria

    • Identification of positively selected residues using dN/dS ratio analysis

    • Conservation mapping onto predicted structural models

  • Structural bioinformatics:

    • Homology modeling based on available structures of related fluoride channels

    • Molecular dynamics simulations in different membrane compositions

    • Electrostatic surface analysis to identify species-specific differences

  • Genomic context analysis:

    • Operon structure comparison across species

    • Identification of co-evolved genes suggesting functional relationships

    • Regulatory element prediction in promoter regions

Comparative genomic analysis between coral-associated Prosthecochloris and free-living relatives has already revealed specialized adaptations including CO oxidation, CO₂ hydration, and sulfur oxidation capabilities . Similar approaches applied specifically to CrcB homologs may reveal how this protein contributes to the remarkable ecological versatility of green sulfur bacteria across diverse environments.

How can issues with protein aggregation during CrcB homolog purification be resolved?

Membrane protein aggregation represents one of the most significant challenges in CrcB homolog research. Systematic troubleshooting approaches include:

IssuePotential CausesSolutionsVerification Method
Immediate precipitation post-lysisInadequate detergent concentrationIncrease detergent:protein ratioDynamic light scattering
Gradual aggregation during purificationDetergent micelle destabilizationAdd glycerol (5-10%) and test detergent mixturesSize exclusion chromatography
Concentration-dependent aggregationProtein-protein interactionsAdd specific lipids (POPE, POPG) to stabilize native conformationNegative stain EM
Temperature-sensitive aggregationHydrophobic domain exposureMaintain samples at 4°C and add stabilizing agentsThermal shift assay
Buffer-dependent aggregationIonic strength or pH issuesScreen buffer conditions systematicallyAnalytical ultracentrifugation

For CrcB homologs specifically, addition of fluoride ions at low concentrations (0.1-1mM) during purification may stabilize the protein by occupying binding sites and maintaining native conformation. Additionally, amphipathic polymers like amphipols or SMALPs (Styrene Maleic Acid Lipid Particles) offer alternative approaches to traditional detergent purification.

What strategies address reproducibility challenges in functional assays for CrcB homolog activity?

Ensuring reproducibility in functional characterization of CrcB homologs requires addressing several potential sources of variability:

  • Protein quality control:

    • Implement rigorous quality checks before functional assays

    • Quantify monodispersity via SEC-MALS

    • Verify protein stability over the timeframe of functional assays

  • Standardized reconstitution protocols:

    • Establish precise lipid:protein ratios

    • Control liposome size distribution via extrusion

    • Verify protein orientation in liposomes

  • Assay optimization:

    • Calibrate fluoride-sensitive probes under experimental conditions

    • Include internal standards in each experiment

    • Minimize background fluoride contamination

  • Experimental design improvements:

    • Implement Solomon Four-Group design when testing treatment effects

    • Include biological replicates from independent protein preparations

    • Blind analysis of experimental results where possible

  • Data analysis standardization:

    • Apply consistent mathematical models for transport kinetics

    • Use statistical approaches appropriate for the data distribution

    • Report all experimental parameters in publications

Utilizing proper experimental design principles as outlined in Campbell and Stanley's framework can substantially improve reproducibility by controlling for threats to internal validity such as history, maturation, and instrumentation effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.