Recombinant Prosthecochloris vibrioformis Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Prosthecochloris vibrioformis Cobalamin synthase (cobS) is a genetically engineered enzyme critical for cobalamin (vitamin B₁₂) biosynthesis. This protein catalyzes the final steps of cobalamin assembly, facilitating the incorporation of the lower ligand into the corrin ring structure . Its recombinant form is produced in heterologous hosts like Escherichia coli or yeast for research and industrial applications, enabling studies on cobamide metabolism and microbial interactions .

Gene and Protein Characteristics

Gene:

  • Locus: Cvib_0823 in Prosthecochloris vibrioformis DSM 260 .

  • Function: Encodes cobalamin synthase (EC 2.-.-.-), a key enzyme in adenosylcobalamin biosynthesis .

Protein:

  • Size: 249 amino acids (27.8 kDa) .

  • Structure: Predicted to contain conserved domains for cobalt-precorrin-6A carboxy-lyase activity .

  • Host Systems: Expressed in E. coli, yeast, baculovirus, or mammalian cells with ≥85% purity (SDS-PAGE) .

Catalytic Role in Cobamide Remodeling

cobS participates in cobamide remodeling, a process allowing bacteria to modify exogenous cobalamin precursors . In Vibrio cholerae, cobS collaborates with novel enzymes like CbiR to replace lower ligands, enhancing metabolic flexibility .

Oxygen Tolerance and Coral Symbiosis

Prosthecochloris vibrioformis employs cobS in coral skeletons, where it adapts to diurnal oxygen fluctuations via:

  • Gas vesicles for vertical migration .

  • cbb₃-type cytochrome c oxidases to tolerate oxidative stress .

Research Tools

  • ELISA Kits: Recombinant cobS is used in immunoassays (e.g., product MBS1108390) for detecting cobalamin-related pathways .

  • Metabolic Engineering: Facilitates vitamin B₁₂ production in synthetic biology platforms .

Industrial Relevance

  • Purity: ≥85% as confirmed by SDS-PAGE, ensuring reliability for structural studies .

  • Scalability: Compatible with high-yield expression systems (e.g., E. coli) .

Genomic Context

  • Genomic Locus: Adjacent to pckG (phosphoenolpyruvate carboxykinase) and mrpA (Na⁺/H⁺ antiporter), suggesting regulatory links to carbon and ion metabolism .

  • Horizontal Gene Transfer (HGT): cobS operons are flanked by mobile genetic elements (MGEs), indicating evolutionary adaptability .

Comparative Genomics

SpeciesGenome Size (Mbp)GC Content (%)Host SystemKey Feature
P. vibrioformis DSM 2602.3152.1E. coliCoral skeleton adaptation
P. marina SCSIO W11013.0252.4Enrichment cultureCO oxidation capacity
P. ethylica DSM 16852.4455.1Syntrophic cultureEthanol metabolism

Data sourced from .

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve catalytic mechanisms.

  • Ecological Impact: Investigate cobS’s role in marine microbial consortia and coral holobiont resilience .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
cobS; Cvib_0823; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Chlorobium phaeovibrioides (strain DSM 265 / 1930) (Prosthecochloris vibrioformis (strain DSM 265))
Target Names
cobS
Target Protein Sequence
MLSGLVSAIRTLTIFSVPGKDAENFSSSLYWFPVVGAFLGTLLAACAWLPLSIGWSELAS AVVVVGGFIVSRGMHADGLADMADGFWGGGDRERTLSIMKDPTVGSFGALALLSLMLLKW VAILRLTEHGAFALIASGVLLGRLSQVLLAASLPYARKEGGTASGFVGGAGRTHAAVALA LSLMMTLPFFYRDPFLLFLLFGAALTAAALIGFLSMKKIGGITGDVLGAVSEVTELFVWL AAGVAFTAF
Uniprot No.

Target Background

Function
Catalyzes the combination of adenosylcobinamide-GDP and alpha-ribazole to produce adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prosthecochloris vibrioformis and how does it relate to cobalamin biosynthesis?

Prosthecochloris vibrioformis (strain 6030, DSM 260T) is a species of green sulfur bacteria (GSB) belonging to the family Chlorobiaceae. This anaerobic phototroph contains bacteriochlorophyll c and d pigments organized in specialized structures called chlorosomes . Like other GSB, P. vibrioformis possesses the genetic machinery for cobalamin biosynthesis, including genes encoding cobalt chelatases and other enzymes necessary for vitamin B12 production. The genome of the related GSB Chlorobaculum tepidum contains complete pathways for tetrapyrrole metabolism, indicating that GSB are not auxotrophic for these compounds . The cobalamin synthase (CobS) enzyme specifically catalyzes the attachment of the upper axial ligand (5'-deoxyadenosyl group) to the corrin ring structure during the final stages of vitamin B12 biosynthesis.

What structural characteristics define recombinant P. vibrioformis CobS?

Recombinant P. vibrioformis CobS belongs to the ATP-dependent cobalamin synthase family, exhibiting several structural characteristics:

  • A Rossmann fold in the N-terminal domain for nucleotide binding

  • Conserved motifs for coordinating with divalent metal ions (typically Mg2+)

  • A substrate-binding pocket shaped to accommodate the corrin ring structure

  • Key catalytic residues positioned to facilitate adenosylation of the corrin substrate

  • Domains arranged to enable cooperative binding of ATP and corrinoid substrates

While the specific crystal structure of P. vibrioformis CobS has not been reported in the provided search results, structural predictions can be made based on homology to other CobS enzymes and the metabolic characteristics of GSB.

How does the anaerobic environment influence CobS function and expression?

P. vibrioformis is an anaerobic phototroph, and its CobS enzyme has evolved to function optimally in oxygen-free environments. Several key considerations for recombinant expression include:

  • Expression systems must account for oxygen sensitivity

  • Reducing conditions need to be maintained during purification

  • Enzyme activity assays require anaerobic conditions for accurate results

  • The catalytic mechanism may involve unique features adapted to anoxic environments

The anaerobic lifestyle of P. vibrioformis affects the regulation of metabolic pathways including cobalamin biosynthesis, which is integrated with other cellular processes such as photosynthesis . The oxygen-free environment likely shapes the structural stability and catalytic efficiency of CobS in ways that differ from aerobic cobalamin synthases.

How does recombinant P. vibrioformis CobS integrate with photosynthetic metabolism?

P. vibrioformis performs anoxygenic photosynthesis using hydrogen sulfide as an electron donor instead of water . The relationship between photosynthesis and cobalamin biosynthesis involves several interconnected aspects:

  • Cobalamin serves as a cofactor for enzymes involved in bacteriochlorophyll synthesis

  • Energy generated through photosynthesis provides ATP for the energy-intensive cobalamin biosynthetic pathway

  • Regulatory networks likely coordinate expression of photosynthetic and cobalamin biosynthetic genes

  • The reducing environment created by photosynthetic electron transport may support cobalamin biosynthesis

In P. vibrioformis, photosynthetic activity occurs via light absorption by chlorosomes, followed by energy transfer through the Fenna-Matthews-Olson (FMO) complex to the reaction center . This energy generation mechanism indirectly supports cobalamin biosynthesis by providing the metabolic resources required for the multistep pathway.

What is the relationship between sulfur metabolism and CobS activity?

P. vibrioformis, like other GSB, oxidizes hydrogen sulfide to elemental sulfur during anoxygenic photosynthesis . This sulfur metabolism potentially influences CobS activity in several ways:

  • Sulfur metabolism generates reducing equivalents that may maintain the redox environment needed for optimal CobS activity

  • Sulfur availability may indirectly regulate cobalamin biosynthesis through metabolic coupling

  • Sulfide:quinone reductase (SQR) and dissimilatory sulfite reductase (DSR) systems produce menaquinol, which feeds electrons into the photosynthetic electron transport chain

  • The sulfur-based energy metabolism creates a unique cellular environment that may affect protein folding and enzyme function

Research into P. vibrioformis CobS should consider these metabolic interconnections, particularly when designing expression systems or analyzing in vivo activity.

How do the ecological niches of various Prosthecochloris species affect CobS evolution?

Prosthecochloris species have been found in diverse ecological niches, including freshwater, marine environments, and notably, as endolithic symbionts in coral skeletons . Coral-associated Prosthecochloris (CAP) form a distinct phylogenetic clade separate from free-living Prosthecochloris species . This ecological diversity likely drives CobS evolution:

  • Habitat-specific selective pressures may lead to enzyme variants with different kinetic properties

  • Symbiotic relationships, like those observed in coral skeletons, could drive co-evolution of metabolic pathways

  • Light availability in different niches may influence the regulation of cobalamin biosynthesis

  • CAP species exhibit specific adaptations to their endolithic lifestyle, which may extend to their cobalamin biosynthetic enzymes

Research comparing CobS enzymes from different Prosthecochloris ecological variants could reveal important insights into the adaptive evolution of this enzyme.

What expression systems are optimal for recombinant P. vibrioformis CobS?

Based on research with similar anaerobic enzymes, the following expression systems show promise for recombinant P. vibrioformis CobS:

Expression SystemAdvantagesLimitations
E. coli BL21(DE3) with pET vectorsHigh expression levels, well-established protocolsPotential for inclusion body formation
E. coli Rosetta™ strainsBetter handling of rare codons found in P. vibrioformisMay require optimization for anaerobic expression
Cold-inducible systems (pCold vectors)Improved folding at lower temperaturesLonger expression times required
Anaerobic expression chambersMaintains native-like conditionsTechnically challenging, lower yields
Co-expression with chaperonesImproved folding efficiencyIncreased system complexity

When expressing recombinant P. vibrioformis CobS, consider:

  • Using a low-oxygen or anaerobic environment during induction

  • Including reducing agents in the media and buffers

  • Optimizing induction temperature and duration for soluble protein production

  • Co-expressing with enzymes that produce needed cofactors

What purification strategies preserve the highest activity of recombinant CobS?

Purification of recombinant P. vibrioformis CobS requires special consideration to maintain enzyme activity:

  • All steps should be performed under reduced oxygen conditions when possible

  • Buffer systems should include:

    • 50-100 mM phosphate or HEPES buffer (pH 7.5-8.0)

    • 1-5 mM reducing agents (DTT, β-mercaptoethanol, or TCEP)

    • 10% glycerol as a stabilizing agent

    • Protease inhibitors to prevent degradation

  • Recommended purification scheme:

    • Initial IMAC (Immobilized Metal Affinity Chromatography) for His-tagged constructs

    • Ion exchange chromatography as an intermediate step

    • Size exclusion chromatography as a final polishing step

  • Activity retention can be monitored at each purification stage using appropriate assays

What assay methods effectively measure recombinant P. vibrioformis CobS activity?

Several complementary approaches can be used to assess CobS activity:

Assay MethodMeasurement PrincipleAdvantagesTechnical Considerations
HPLC analysisDirect quantification of cobalamin productsHigh specificity, quantitativeRequires specialized equipment, time-consuming
UV-Vis spectroscopySpectral changes during corrin ring modificationRapid, non-destructiveLower sensitivity, potential interference
Coupled enzyme assaysMonitoring ATP consumptionContinuous measurement, high sensitivityIndirect measure, requires additional enzymes
Radioactive assaysIncorporation of labeled precursorsHigh sensitivity, mechanistic insightsSafety concerns, specialized facilities needed
Mass spectrometryProduct identification and quantificationDefinitive product characterizationSample preparation complexity, specialized equipment

For optimal results, assays should be performed under anaerobic conditions using purified substrates and appropriate controls.

How can site-directed mutagenesis inform the reaction mechanism of P. vibrioformis CobS?

Site-directed mutagenesis provides powerful insights into CobS function through systematic modification of key residues:

  • Target residues for mutagenesis should include:

    • Conserved motifs involved in ATP binding and hydrolysis

    • Residues predicted to interact with the corrin substrate

    • Amino acids unique to anaerobic CobS variants

    • Residues implicated in protein-protein interactions

  • Mutational analysis workflow:

    • Generate single-site mutants using established PCR-based methods

    • Express and purify mutant proteins under conditions identical to wild-type

    • Assess structural integrity through circular dichroism or thermal stability assays

    • Perform detailed kinetic analysis comparing mutant and wild-type activities

  • Interpreting mutagenesis results:

    • Changes in kcat indicate roles in catalysis

    • Altered KM values suggest involvement in substrate binding

    • Mutations affecting protein stability may reveal structural determinants

    • Conservation analysis across GSB can highlight functionally critical residues

What spectroscopic techniques reveal insights into CobS reaction intermediates?

Multiple spectroscopic approaches provide complementary information about CobS catalysis:

  • UV-Visible spectroscopy:

    • Monitors changes in the corrin ring π-electron system during catalysis

    • Can track reaction progress in real-time under anaerobic conditions

    • Provides distinct spectral signatures for different reaction intermediates

  • Electron Paramagnetic Resonance (EPR) spectroscopy:

    • Directly examines the cobalt coordination environment

    • Distinguishes between Co(II) and Co(III) oxidation states

    • Can capture transient radical intermediates during catalysis

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Maps structural changes during substrate binding

    • Tracks chemical environment changes during reaction progression

    • Can be combined with isotope labeling for mechanistic studies

  • Time-resolved techniques:

    • Stopped-flow methods capture millisecond reaction kinetics

    • Freeze-quench approaches trap transient intermediates for detailed analysis

How do environmental factors affect recombinant P. vibrioformis CobS stability and activity?

P. vibrioformis CobS has evolved in a specific environmental context that should inform experimental design:

Environmental FactorImpact on CobSExperimental Considerations
Oxygen exposurePotential inactivation through oxidation of metal centers or cysteine residuesMaintain anaerobic conditions during all experimental procedures
TemperatureAffects stability and reaction ratesOptimize reactions at 30-37°C; consider thermal stability assays
pHInfluences protonation states of catalytic residuesBuffer systems at pH 7.5-8.0 typically optimal
LightMay affect associated photosynthetic regulatory systemsControl light exposure during growth and experiments
Redox potentialCritical for maintaining proper enzyme activityInclude appropriate reducing agents; consider redox buffering
Salt concentrationAffects protein solubility and substrate bindingOptimize ionic strength for maximum activity

Understanding these environmental factors is crucial for designing experiments that accurately reflect the native function of P. vibrioformis CobS.

How might syntrophic relationships influence CobS function in coral-associated Prosthecochloris?

Recent research has identified coral-associated Prosthecochloris (CAP) in symbiotic relationships with coral and other microorganisms . These relationships may influence CobS function:

  • CAP and sulfate-reducing bacteria (SRB) appear to establish syntrophic relationships in coral skeletons

  • SRB may provide reduced sulfur compounds that support CAP metabolism

  • This metabolic coupling could influence regulation of cobalamin biosynthesis

  • The coral skeleton microenvironment may create unique conditions affecting enzyme function

Research comparing CobS from free-living P. vibrioformis and coral-associated variants could reveal adaptations to symbiotic lifestyles and provide insights into evolutionary mechanisms.

What computational approaches can predict CobS substrate specificity and inhibitor binding?

Modern computational methods offer powerful tools for studying P. vibrioformis CobS:

  • Homology modeling:

    • Construction of 3D models based on known structures of related enzymes

    • Refinement through molecular dynamics simulations

    • Validation through experimental structure-function studies

  • Molecular docking:

    • Prediction of substrate binding modes and energetics

    • Virtual screening for potential inhibitors

    • Structure-based design of substrate analogs

  • Quantum mechanical/molecular mechanical (QM/MM) calculations:

    • Detailed examination of electron transfer during catalysis

    • Mapping of transition states and reaction coordinates

    • Prediction of the effects of mutations on activation barriers

  • Machine learning approaches:

    • Prediction of protein-protein interaction networks

    • Identification of regulatory patterns based on genomic context

    • Classification of CobS variants based on functional characteristics

How can synthetic biology approaches utilize recombinant P. vibrioformis CobS?

Recombinant P. vibrioformis CobS offers several opportunities for synthetic biology applications:

  • Engineered vitamin B12 production:

    • Optimized expression systems for industrial cobalamin biosynthesis

    • Pathway engineering to increase yields and reduce byproducts

    • Creation of chimeric enzymes with enhanced catalytic properties

  • Biosensor development:

    • CobS-based sensors for detecting metabolic intermediates

    • Coupled enzyme systems for monitoring environmental parameters

    • Cell-free diagnostic platforms utilizing CobS activity

  • Metabolic engineering:

    • Integration of cobalamin biosynthesis into heterologous hosts

    • Creation of artificial syntrophic relationships based on cobalamin dependence

    • Enhancement of photosynthetic efficiency through optimized cofactor production

  • Ecological applications:

    • Development of bioremediation strategies using engineered P. vibrioformis

    • Creation of synthetic communities for environmental management

    • Study of host-microbe interactions in coral reef ecosystems

These applications represent frontier areas where basic research on P. vibrioformis CobS can translate into practical biotechnological innovations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.