Recombinant Prosthecochloris vibrioformis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Prosthecochloris vibrioformis

Prosthecochloris vibrioformis is a green sulfur bacterium (GSB) . GSB are nonmotile bacteria capable of anoxygenic photosynthesis . P. vibrioformis belongs to a specialized phylogenetic lineage of green sulfur bacteria adapted for marine and saltwater ecosystems . They are often observed in stratified lakes, where they can dominate the community at specific depths, sometimes forming clonal blooms . Prosthecochloris, a marine representative genus of GSB, was found to be dominant in some coral skeletons .

Function of MscL

MscL channels generally function as emergency release valves, opening in response to extreme membrane tension to prevent cell lysis .

Research Findings

While direct research findings specifically on recombinant Prosthecochloris vibrioformis MscL are not available, studies on MscL channels in other bacteria and Prosthecochloris vibrioformis provide relevant information:

  • Habitat Adaptation: Prosthecochloris species demonstrate adaptive strategies to thrive in specific microenvironments, such as coral skeletons, using mechanisms like variable polysaccharide synthesis and phage defense systems . Mobile genetic elements also play a crucial role in their evolutionary diversification .

  • Metabolic Capabilities: Prosthecochloris vibrioformis can tolerate relatively high oxygen concentrations and have a high tolerance and affinity for sulfide, enabling them to outcompete other bacteria under certain conditions . They also contain genes for bacteriochlorophyll biosynthesis .

  • CRISPR-Cas Systems: Prosthecochloris species possess CRISPR-Cas systems, indicating they are subject to viral predatory stress, with host immunity playing an active role .

  • Genome Sequencing: Simultaneous genome sequencing of Prosthecochloris ethylica has revealed unique pili and protein .

  • Ecophysiology: Prosthecochloris are adapted to low light conditions and respond to different wavelengths of light, allowing them to thrive at certain depths in aquatic environments where they outcompete other phototrophs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Cvib_0845; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Chlorobium phaeovibrioides (strain DSM 265 / 1930) (Prosthecochloris vibrioformis (strain DSM 265))
Target Names
mscL
Target Protein Sequence
MMKQFKEFAVRGNVVDMAVGIIVGGAFGKLVNTLVSDVMMPPLGFLTGGVDFTNLYFVLS EGSTPGPYAALEQARAAGAVTVNYGLFINAMISFIIMAFAVYLLVRGINSLRRKEEAAPP PSTKQCPFCLSTVPLKATRCPACTSGLEK
Uniprot No.

Target Background

Function
A mechanosensitive ion channel that opens in response to membrane tension. It is believed to play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prosthecochloris vibrioformis and what ecological niches does it occupy?

Prosthecochloris vibrioformis is a distinct species of green sulfur bacteria (GSB) belonging to the phylum Chlorobi. It represents a specialized group of anoxygenic phototrophic bacteria characterized by its rod-shaped morphology, often forming coiled structures. Unlike other members of the Prosthecochloris genus that typically have spherical or ovoid shapes, P. vibrioformis exhibits a vibrio-like (curved rod) morphology.

P. vibrioformis can be found in diverse ecological niches, primarily anaerobic environments rich in hydrogen sulfide. It has been isolated from:

  • Rivermouth environments

  • Saline lake waters

  • Hydrogen sulfide-rich mud

  • Coastal brackish lagoons

Interestingly, while the genus name Prosthecochloris refers to the presence of prosthecae (appendages), P. vibrioformis itself does not actually produce these structures. Additionally, P. vibrioformis produces gas vesicles, a characteristic that distinguishes it from several other Prosthecochloris species and likely provides advantages in planktonic environments .

What is the MscL channel and what is its primary function in bacteria?

The mechanosensitive channel of large conductance (MscL) is a membrane protein that forms one of the largest pores known in nature, with a diameter exceeding 25 Å when fully open. This channel plays a critical protective role in bacterial osmoregulation, functioning as a "safety valve" during hypoosmotic shock.

MscL's primary functions include:

  • Protection against osmotic lysis: MscL opens in response to increased membrane tension (approximately 10-12 mN/m) during hypoosmotic shock, allowing the rapid release of cytoplasmic osmolytes to relieve excessive turgor pressure before cell rupture occurs .

  • Formation of a nonselective pore: When open, MscL creates a large-conductance (~3 nS) channel that allows passage of ions, small proteins, and various organic molecules .

  • Direct mechanosensing: Unlike many sensory systems that require signal transduction cascades, MscL directly transduces mechanical force from the lipid bilayer to channel gating, making it an excellent model system for studying fundamental principles of mechanosensory transduction .

The channel's ability to sense membrane tension occurs without requiring additional cellular components, as demonstrated by its retained mechanosensitivity when reconstituted into artificial lipid bilayers .

What is known about the structure of MscL and how does it relate to function?

The structure of MscL has been extensively studied using multiple experimental approaches, revealing key structural elements that contribute to its mechanosensing properties:

The structure-function relationship in MscL demonstrates how evolutionary design has created a channel that remains closed under normal conditions but can rapidly open a large pore when membrane tension exceeds a threshold value.

What techniques are most effective for studying MscL gating mechanisms?

Studying MscL gating mechanisms requires a multi-faceted approach combining functional, structural, and computational methods:

  • Electrophysiology techniques:

    • Patch clamp recording serves as the gold standard for direct functional measurement of MscL activity, allowing researchers to precisely control membrane tension while monitoring channel conductance, open probability, and gating kinetics .

    • Giant spheroplasts or reconstituted proteoliposomes can be used for patch clamp studies, with the latter offering greater control over lipid composition.

  • Spectroscopic approaches:

    • Pulsed electron paramagnetic resonance (EPR) spectroscopy:

      • PELDOR/DEER (Pulsed electron-electron double resonance) measures distances between spin-labeled residues with Ångström resolution, tracking conformational changes during gating .

      • ESEEM (Electron spin echo envelope modulation) monitors changes in solvent accessibility of specific residues during channel activation .

    • Fluorescence resonance energy transfer (FRET) spectroscopy enables measurement of distance changes between fluorophore-labeled residues during channel gating .

  • Mass spectrometry techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) identifies regions with altered solvent accessibility during gating .

    • Native mass spectrometry determines the effects of detergents and lipids on channel stoichiometry .

    • Ion mobility mass spectrometry defines subconducting states in response to pore modifications .

  • Computational approaches:

    • Molecular dynamics (MD) simulations model channel response to membrane tension and interactions with surrounding lipids .

    • Brownian dynamics simulations can model ion permeation through the channel pore .

  • Functional assays:

    • Cell viability and osmotic downshock assays test the protective function of MscL variants in bacterial cells .

    • In vivo reporter assays can monitor channel activity in response to various stimuli.

Each technique provides complementary information, with the most robust insights coming from integrated approaches that combine multiple methods within the same study.

How can MscL be functionally expressed in heterologous systems?

The functional expression of MscL in heterologous systems requires careful consideration of various factors to maintain proper folding, membrane insertion, and mechanosensitive properties:

  • Expression systems for basic research:

    • Escherichia coli: The most commonly used system for heterologous expression of MscL due to its simplicity and high protein yields. Often requires deletion of endogenous mscL to study specifically the heterologous channel.

    • Cell-free expression systems: Useful for rapid screening and when the channel might be toxic to living cells.

    • Mammalian cells: More challenging but valuable for studies of MscL function in eukaryotic membranes and for biotechnology applications .

  • Vector design considerations:

    • Promoter selection based on desired expression level

    • Addition of affinity tags for purification (typically His-tags)

    • Inclusion of fluorescent protein fusions for localization studies

    • Codon optimization for the selected expression host

    • Signal sequences if required for proper membrane targeting

  • Expression validation methods:

    • Western blotting to confirm protein expression

    • Fluorescence microscopy for localization (with fluorescent tags)

    • Patch clamp electrophysiology to verify functional expression and mechanosensitivity

    • Osmotic downshock assays to test channel function in bacterial systems

  • Challenges and solutions:

    • Protein misfolding: Optimization of induction conditions (temperature, inducer concentration)

    • Toxicity: Use of tightly regulated promoters or leaky expression systems

    • Membrane targeting: Inclusion of appropriate signal sequences

    • Functional verification: Development of high-throughput screening methods

  • Reconstitution approaches:

    • Detergent solubilization using mild detergents that maintain protein function

    • Reconstitution into liposomes or nanodiscs for functional studies

    • Control of protein orientation and density in reconstituted systems

The successful heterologous expression of MscL has enabled numerous structural and functional studies and has opened possibilities for biotechnological applications, including controlled delivery of bioactive molecules into cells .

What experimental approaches enable modulation of MscL channel activity?

Multiple experimental approaches have been developed to modulate and control MscL channel activity, with applications in both basic research and biotechnology:

  • Physiological activation methods:

    • Direct membrane stretch via patch pipette suction in electrophysiology

    • Osmotic downshock to create membrane tension in cellular systems

    • Addition of amphipathic molecules like lysophosphatidylcholine (LPC) that insert asymmetrically into the membrane to induce curvature and tension

  • Genetic engineering approaches:

    • Site-directed mutagenesis of pore-lining residues to alter tension sensitivity

    • Introduction of specific mutations that stabilize intermediate or open states

    • Creation of gain-of-function or loss-of-function mutants

    • Example: The L89W mutation in TbMscL (corresponding to M94 in EcMscL) stabilizes an expanded subconducting state

  • Chemical modification strategies:

    • Cysteine-specific chemical modifications at engineered sites

    • Attachment of charged compounds to alter local electrostatics

    • Coupling with environment-responsive molecules for stimulus-specific gating

    • Example: G22C mutation coupled with sulfhydryl-reactive modulators creates pH-sensitive channels

  • Light-controlled activation:

    • Attachment of photoswitchable compounds to engineered cysteine residues

    • Light-induced conformational changes in these compounds alter channel gating

    • Provides spatial and temporal control of channel activation

  • Lipid environment manipulation:

    • Alteration of bilayer thickness through lipid composition changes

    • Modification of membrane stiffness via cholesterol content

    • Introduction of lipids with specific intrinsic curvature

    • These approaches affect the energetics of channel opening

  • Charge-induced activation:

    • Introduction of charged molecules that interact with specific channel regions

    • Creation of electrostatic repulsion or attraction to stabilize open states

    • Particularly useful for controlled delivery applications in cellular systems

These modulation approaches have significantly advanced our understanding of MscL's gating mechanism and created opportunities for using MscL as a controllable nanovalve in various biotechnological applications.

How does the N-terminal domain influence MscL function and tension sensitivity?

The N-terminal domain of MscL plays critical roles in channel function and tension sensitivity through several mechanisms:

  • Structural stabilization of the closed state:

    • Deletion studies show that removing portions of the N-terminus creates channels requiring less force to gate, indicating its role in stabilizing the closed conformation .

    • The most severe loss of sensitivity was observed with the Δ2-7 construct, demonstrating the importance of these specific residues .

  • Electrostatic interactions:

    • The N-terminus forms important electrostatic interactions with other regions of the channel.

    • Glutamate residues (E6 and E9) on the N-terminus interact with other parts of the channel, creating stabilizing forces .

    • Removal of lysine at position 5 (K5) results in increased mobility of TM2, suggesting that K5 is crucial for maintaining N-terminus-TM2 interactions .

  • Membrane coupling function:

    • The amphipathic nature of the N-terminal helix allows it to interact with both the membrane and the channel protein.

    • This domain acts as a crucial structural element for coupling membrane tension to channel gating .

    • Continuous wave electron paramagnetic resonance (cwEPR) spectroscopy and molecular dynamics simulations show that lipids strongly interact with the N-terminus during channel expansion .

  • The "dragging" model of mechanosensation:

    • The N-terminus can move with the membrane during tension changes, "dragging" the connected transmembrane domains .

    • This mechanism efficiently translates membrane deformation into channel conformational changes.

  • Intersubunit interactions:

    • The N-terminus of one subunit (i) comes into close proximity with TM2 of another subunit (i+2) .

    • These interactions create a network of contacts that contribute to the cooperative nature of channel gating.

  • Mobility changes during gating:

    • Experimental evidence shows progressive changes in TM2 mobility when residues of the N-terminus are deleted .

    • These mobility patterns increasingly resemble those seen in the presence of LPC (which stabilizes the open state), confirming the N-terminus role in controlling channel conformation .

Understanding these N-terminal domain functions has provided critical insights into the molecular basis of MscL mechanosensation and created opportunities for targeted modifications to engineer channels with altered gating properties.

How can MscL be engineered as a controlled delivery system for bioactive molecules?

Engineering MscL as a controlled delivery system involves several key strategies to create channels with programmable gating that allows precise control over molecular transport:

  • Basic principles for MscL-based delivery systems:

    • MscL forms a large pore (>25 Å) when open, allowing passage of molecules up to ~6.5 kDa

    • The channel can be engineered to respond to specific stimuli rather than mechanical force

    • When functionally expressed in cells or reconstituted in liposomes, MscL can mediate uptake or release of membrane-impermeable molecules

  • Engineering approaches for stimuli-responsive MscL:

    • Site-directed mutagenesis of the G22 position in the pore region creates a platform for further modifications

    • The G22C mutation introduces a cysteine residue that can be chemically modified with various functional groups

    • Coupling with pH-sensitive compounds creates channels that open in response to pH changes

    • Attachment of photoswitchable molecules enables light-controlled activation

    • Introduction of charged moieties allows for charge-mediated gating

  • Functional expression in target systems:

    • For cellular delivery, MscL can be functionally expressed in mammalian cells while maintaining its gating properties

    • For liposomal drug delivery, purified MscL is reconstituted into liposomes containing therapeutic cargo

    • The method of MscL activation must be compatible with the target system

  • Delivery capabilities and limitations:

    • MscL has been demonstrated to enable uptake of membrane-impermeable molecules such as the bi-cyclic peptide phalloidin (a specific marker for actin filaments)

    • Cargo size limitations can be determined using fluorescently labeled model molecules of different sizes

    • The channel is nonselective, allowing passage of various ions and molecules below the size threshold

  • Advantages of MscL-based delivery systems:

    • Rapid activation kinetics enabling timed delivery

    • Large pore size allowing transport of various biomolecules

    • Multiple options for triggering channel opening

    • Potential for spatial control when using light-activated variants

    • Compatible with both prokaryotic and eukaryotic cellular systems

This versatile platform technology offers promising applications in research tools for cellular biology, targeted drug delivery systems, and responsive materials for biosensing or controlled release.

What ecological and evolutionary insights can be gained from studying Prosthecochloris vibrioformis MscL?

Studying Prosthecochloris vibrioformis MscL provides valuable ecological and evolutionary insights into mechanosensation adaptations across different bacterial phyla and environmental niches:

  • Adaptation to specialized ecological niches:

    • P. vibrioformis inhabits anaerobic, hydrogen sulfide-rich environments that differ substantially from the habitats of model organisms like E. coli

    • Comparing MscL properties across species can reveal adaptations to specific environmental challenges, such as high salinity, pH extremes, or temperature fluctuations

    • The different membrane composition of P. vibrioformis likely influences native MscL function and may have driven evolutionary adaptations in channel properties

  • Evolutionary conservation and divergence:

    • As a green sulfur bacterium, P. vibrioformis represents a different evolutionary lineage than commonly studied proteobacteria or actinobacteria

    • Analyzing conserved features across diverse MscL homologs helps identify critical functional elements maintained through evolutionary history

    • Divergent features may represent adaptations to specific environmental pressures or integration with different cellular systems

  • Insights from syntrophic relationships:

    • P. vibrioformis can form syntrophic relationships with sulfur- and sulfate-reducing bacteria, where metabolic products are exchanged between species

    • These close associations may influence membrane properties and potentially MscL function in ways that differ from free-living bacteria

    • Coral-associated Prosthecochloris strains (CAP) show genomic adaptations to their endolithic lifestyle, which may extend to MscL properties

  • Horizontal gene transfer considerations:

    • Mobile genetic elements (MGEs) play important roles in the evolutionary diversification of Prosthecochloris strains

    • Studying whether mscL genes show evidence of horizontal gene transfer could reveal mechanisms of mechanosensation adaptation

    • Comparing mscL gene neighborhoods across species may identify co-evolved gene clusters related to osmotic stress responses

  • Biotechnological implications:

    • Different MscL homologs may offer experimental advantages for specific applications

    • P. vibrioformis MscL could potentially exhibit unique properties valuable for biotechnological applications

    • Comparative studies across MscL homologs facilitate the identification of optimal candidates for protein engineering approaches

This comparative evolutionary perspective enhances our fundamental understanding of mechanosensation while potentially identifying novel features that could be exploited for biotechnological applications.

What comparative analyses reveal differences between MscL proteins from diverse bacterial species?

Comparative analyses of MscL proteins from different bacterial species, including Prosthecochloris vibrioformis, reveal important insights about structural conservation, functional adaptations, and evolutionary relationships:

  • Sequence conservation patterns:

    MscL proteins show varying degrees of sequence identity across bacterial phyla, with highest conservation in:

    • Pore-lining TM1 domain, particularly the constriction residues

    • Key residues involved in intersubunit interactions

    • The amphipathic N-terminal helix

    Lower conservation is typically observed in:

    • Loop regions

    • C-terminal domains

    • Specific lipid-interacting residues that may adapt to different membrane environments

  • Structural variations:

    SpeciesNotable Structural FeaturesReference
    M. tuberculosisCrystal structure available; more compact closed state
    E. coliWell-characterized gating transitions; pentameric assembly
    P. vibrioformisSpecific adaptations to anaerobic environments
    Prosthecochloris sp. HL-130-GSBAdaptations to hot lake environment with high MgSO₄
  • Functional differences:

    • Tension sensitivity thresholds vary between species, likely reflecting adaptations to different osmotic challenges

    • Channel conductance and ion selectivity show species-specific variations

    • Response to lipid environment modifiers differs between MscL homologs

    • Differences in interaction with other components of osmotic stress response systems

  • Evolutionary relationships:

    • MscL is widely distributed across bacterial phyla, suggesting early evolutionary origin

    • Prosthecochloris and other green sulfur bacteria represent a distinct evolutionary lineage from model organisms like E. coli

    • Phylogenetic analysis of MscL sequences generally aligns with established bacterial taxonomy

    • Evidence of horizontal gene transfer in some species suggests MscL can be acquired through lateral transfer

  • Experimentally verified functional conservation:

    • Despite sequence divergence, the core mechanosensing mechanism appears conserved

    • Heterologous expression often preserves mechanosensitivity, confirming functional conservation

    • Engineering approaches successful in E. coli MscL can frequently be transferred to homologs from other species

    • Chimeric channels combining domains from different species can maintain function, highlighting modular architecture

  • Environmental adaptations:

    • MscL from extremophiles shows adaptations to specific environmental stressors

    • Differences in membrane composition across species correlate with variations in MscL properties

    • Coral-associated Prosthecochloris strains show genomic adaptations that may extend to mechanosensation mechanisms

These comparative analyses not only enhance our fundamental understanding of mechanosensation but also facilitate the identification of optimal MscL variants for specific research or biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.