Recombinant Prosthecochloris vibrioformis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Key Properties of Recombinant htpX Homolog

ParameterDetailSource
UniProt IDA4SEH5
EC Number3.4.24.- (Metalloprotease)
Gene NamehtpX
LocusCvib_0869
SpeciesProsthecochloris vibrioformis (strain DSM 265)
Molecular Weight~33 kDa (predicted from 291 aa sequence)
Storage Conditions-20°C or -80°C in Tris-based buffer with 50% glycerol; avoid repeated freeze-thaw cycles

Amino Acid Sequence:
The full-length sequence (291 residues) includes conserved motifs characteristic of M48 metalloproteases, such as zinc-binding sites and catalytic regions. Specific residues (e.g., His, Asp, and Cys) are critical for metal coordination and enzymatic activity .

Genomic Locus and Orthologous Relationships

The htpX gene (Cvib_0869) resides in the Prosthecochloris vibrioformis genome, clustering with genes involved in stress response and membrane protein homeostasis . Comparative genomic studies highlight its conservation in chlorobiota, suggesting a conserved role in managing misfolded membrane proteins .

Key Functional Predictions:

  1. Membrane Localization: Likely embedded in the cytoplasmic membrane, similar to E. coli HtpX .

  2. Zinc Dependency: Requires divalent zinc ions for catalysis, as inferred from E. coli HtpX studies .

  3. Substrate Specificity: Targets misfolded membrane proteins (e.g., SecY in E. coli) via endopeptidolytic cleavage .

Comparative Analysis with E. coli HtpX

FeatureProsthecochloris vibrioformis htpX HomologE. coli HtpXSource
FamilyM48 metalloproteaseM48 metalloprotease
Catalytic MechanismZinc-dependent endopeptidaseZinc-dependent endopeptidase
SubstratesPredicted: misfolded membrane proteinsSecY, FtsH, and other membrane proteins
RegulationStress-induced (inferred)Heat shock response
PurificationRecombinant production (detergent-based extraction)Similar protocols for E. coli HtpX

Key Insights from E. coli Studies:

  • Quality Control: E. coli HtpX degrades misfolded membrane proteins, preventing cellular toxicity .

  • Zinc Coordination: Mutations in zinc-binding residues (e.g., His-123, Asp-167) abolish activity .

  • Self-Cleavage: HtpX undergoes autodegradation under denaturing conditions, requiring zinc for refolding .

Potential Uses in Molecular Biology

  1. Membrane Protein Studies: Investigating proteolytic pathways in chlorobiota.

  2. Structural Analysis: Crystallization or cryo-EM studies to resolve its architecture.

  3. Enzyme Engineering: Designing variants with altered specificity for biotechnological applications.

Challenges:

  • Limited Functional Data: Direct biochemical assays for Prosthecochloris htpX are lacking.

  • Stability Issues: Repeated freeze-thaw cycles compromise activity, necessitating careful handling .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
htpX; Cvib_0869; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Chlorobium phaeovibrioides (strain DSM 265 / 1930) (Prosthecochloris vibrioformis (strain DSM 265))
Target Names
htpX
Target Protein Sequence
MKRVFLFLITNLAVILVLSFSARLLGVDRFLTSNGLDMGMLLAFAALIGFGGSFISLLMS KTMAKWSTGAQVILRPSNEEESWLLNTVRQLSKKADLAMPEVAIYEGAPNAFATGPSRSK SLVAVSSGLLRSMDRKQVEAVLAHEVAHIQNGDMVTLTLIQGVVNTFVIFLARVFAYALD SFLRRDEDESGSPGIGYWISSIAFEIVFGILASIVVMYFSRKREFRADAGAAALIGDRRP MIEALRALGSLEAGKLPKEMAASGIAGGGMMALFSSHPPLESRIAALESAR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX and what cellular functions does it perform?

HtpX belongs to the M48 family of zinc metalloproteinases and is primarily located in the cytoplasmic membrane. Based on studies in Escherichia coli, HtpX is involved in the quality control of membrane proteins and participates in protein degradation pathways . While specific information about Prosthecochloris vibrioformis HtpX is limited in the literature, comparative genomic analysis suggests functional conservation across bacterial species, with potential roles in stress response and membrane protein homeostasis.

How does HtpX from Prosthecochloris vibrioformis compare structurally to other bacterial homologs?

Although the complete structural characterization of P. vibrioformis HtpX is not fully documented, we can draw insights from studies of related bacterial species. The Nitrosococcus oceani HtpX consists of 295 amino acids with conserved metalloprotease domains . Comparative sequence analysis reveals that HtpX proteins across bacterial species maintain key zinc-binding motifs essential for catalytic activity, while exhibiting species-specific variations in non-catalytic regions that may reflect adaptation to different membrane environments or substrate specificities.

What genomic context surrounds the htpX gene in Prosthecochloris species?

While specific htpX gene neighborhood information for P. vibrioformis is not directly provided in the available data, genomic analysis techniques similar to those used for other Prosthecochloris species can be applied. As demonstrated in the genome sequencing of Prosthecochloris ethylica, synteny analysis can reveal conserved gene clusters and their evolutionary relationships . Such analysis for htpX would potentially identify functionally related genes and regulatory elements that coordinate with protease activity under various environmental conditions.

What expression systems yield optimal results for recombinant Prosthecochloris HtpX production?

Based on successful approaches with other bacterial proteases, E. coli expression systems with appropriate modifications for membrane proteins offer a practical starting point. The recombinant Nitrosococcus oceani Protease HtpX was successfully expressed in E. coli with an N-terminal His tag . For optimal expression of P. vibrioformis HtpX, consider these methodological adjustments:

  • Use low-copy number vectors with tunable promoters to control expression levels

  • Incorporate appropriate signal sequences for membrane targeting

  • Express at lower temperatures (16-25°C) to enhance proper folding

  • Include appropriate protease inhibitors during purification to prevent autodegradation

  • Consider membrane-mimetic environments during purification to maintain native conformation

How can researchers develop a reliable activity assay for Prosthecochloris HtpX?

  • Construct fusion proteins containing potential transmembrane substrates linked to reporter proteins

  • Establish baseline cleavage patterns using wild-type HtpX

  • Validate specificity using catalytically inactive HtpX mutants

  • Optimize assay conditions (pH, temperature, ion concentrations) reflecting the natural environment of Prosthecochloris

What purification strategies maximize yield and activity of recombinant HtpX?

Purification of membrane-associated proteases requires specialized approaches to maintain structural integrity and activity. Based on successful purification of related proteins, a multi-step strategy is recommended:

  • Solubilize membrane fractions with mild detergents (DDM, LDAO, or Brij-35)

  • Perform initial capture using immobilized metal affinity chromatography if His-tagged (as used for N. oceani HtpX)

  • Apply secondary purification via ion exchange or size exclusion chromatography

  • Consider reconstitution into nanodiscs or liposomes to maintain native-like environment

  • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0 with 5-50% glycerol for long-term stability

How do environmental stressors affect HtpX expression and activity in Prosthecochloris?

While direct data on P. vibrioformis HtpX stress response is limited, insights can be drawn from studies of related heat shock proteins. For instance, HtpG in Vibrio vulnificus contributes significantly to cold shock recovery, with mutants showing delayed recovery compared to wild-type (p<0.05) . For investigating HtpX responses to environmental stressors:

  • Design quantitative PCR assays to measure htpX transcript levels under various stress conditions

  • Develop reporter systems fusing the htpX promoter to fluorescent proteins

  • Compare growth and survival phenotypes between wild-type and htpX deletion mutants under stress conditions

  • Monitor protein levels using specific antibodies across a time course following stress exposure

What is the substrate specificity profile of Prosthecochloris HtpX?

Determining substrate specificity requires systematic analysis using both candidate and unbiased approaches. While physiological substrates of HtpX have not been fully characterized even in model organisms like E. coli , researchers can:

  • Perform comparative proteomics between wild-type and ΔhtpX strains under various conditions

  • Develop in vitro cleavage assays using synthetic peptide libraries representing transmembrane domains

  • Utilize bioinformatic prediction tools to identify potential substrates based on sequence and structural motifs

  • Validate candidates through direct in vitro and in vivo assays with site-directed mutagenesis of predicted cleavage sites

How does HtpX interact with other membrane protein quality control systems?

As a membrane-associated protease, HtpX likely functions within a network of quality control systems. Based on studies in other bacteria, researchers should investigate interactions with:

  • FtsH protease system, which is functionally linked to HtpX in E. coli

  • Chaperone systems that may present substrates to HtpX

  • Stress response regulators that coordinate protease activities

  • Translocon components involved in membrane protein insertion and folding

These interactions can be characterized through co-immunoprecipitation, bacterial two-hybrid assays, or genetic epistasis experiments comparing single and double mutants.

How has the htpX gene evolved across Prosthecochloris species and related green sulfur bacteria?

Evolutionary analysis of htpX can provide insights into its functional specialization. Using approaches similar to those applied to other Prosthecochloris genes , researchers should:

  • Construct phylogenetic trees using both nucleotide and amino acid sequences

  • Calculate selection pressures (dN/dS ratios) across different domains of the protein

  • Identify conserved versus variable regions that might reflect species-specific adaptations

  • Compare synteny across related species to understand genomic context evolution

What role might HtpX play in the adaptation of Prosthecochloris to specific ecological niches?

Prosthecochloris species possess unique adaptations, including specialized adhesion mechanisms. For example, certain Prosthecochloris strains contain Tad pili gene clusters involved in biofilm formation and cell adhesion . HtpX may contribute to niche adaptation by:

  • Regulating membrane protein composition under specific environmental stressors

  • Processing surface proteins involved in cellular interactions

  • Contributing to biofilm formation through proteolytic processing of adhesion factors

  • Participating in stress responses specific to the anaerobic, sulfide-rich environments where Prosthecochloris species thrive

How do structural differences in HtpX across bacterial species reflect functional specialization?

Structural analysis of HtpX homologs can reveal functional adaptations. Researchers investigating this question should:

  • Generate homology models based on crystallized M48 metalloproteases

  • Compare predicted substrate-binding pockets across species

  • Identify species-specific insertions or deletions that might confer specialized functions

  • Perform site-directed mutagenesis of conserved versus variable residues to assess functional importance

What controls are essential for accurately interpreting HtpX activity assays?

Robust experimental design requires appropriate controls. For HtpX activity assays, essential controls include:

  • Catalytically inactive HtpX mutants (e.g., mutations in zinc-binding motifs)

  • Substrate-only controls to assess spontaneous degradation

  • Inhibitor controls using metalloprotease inhibitors like EDTA or 1,10-phenanthroline

  • Positive controls using well-characterized proteases with similar substrate preferences

  • Time-course measurements to distinguish kinetic differences from endpoint results

How can researchers distinguish between direct and indirect effects of HtpX proteolytic activity?

Distinguishing direct substrates from secondary effects presents a significant challenge. Methodological approaches to address this include:

  • In vitro cleavage assays with purified components to demonstrate direct proteolysis

  • Mass spectrometry identification of specific cleavage sites

  • Pulse-chase experiments tracking substrate fate in wild-type versus ΔhtpX strains

  • Construction of non-cleavable substrate variants through site-directed mutagenesis

  • Temporal analysis of proteome changes following controlled HtpX induction

What factors contribute to variability in recombinant HtpX expression and activity?

When troubleshooting inconsistent results with recombinant HtpX, consider these factors:

  • Expression strain variations in membrane composition and proteolytic capacity

  • Detergent selection affecting protein stability and activity

  • Metal ion availability in expression and assay buffers

  • Post-translational modifications varying between expression systems

  • Storage conditions affecting long-term stability (ideally store at -20°C/-80°C, avoiding repeated freeze-thaw cycles)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.