Recombinant Prosthecochloris vibrioformis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Mechanism

Undecaprenyl-diphosphatase (uppP) catalyzes the hydrolysis of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), a lipid carrier essential for transporting peptidoglycan precursors across the bacterial membrane . The reaction is:

UPP+H2OUP+Phosphate(EC 3.6.1.27)\text{UPP} + \text{H}_2\text{O} \rightarrow \text{UP} + \text{Phosphate} \quad (\text{EC 3.6.1.27})
  • Role in Cell Wall Synthesis: UP facilitates the translocation of N-acetylglucosamine (NAG) and N-acetylmuramic acid (NAM) subunits during peptidoglycan assembly .

  • Antibiotic Resistance: UppP activity is linked to bacitracin resistance by recycling UPP, which is targeted by this antibiotic .

A. Cell Envelope Stress Studies

Depleting uppP in Bacillus subtilis disrupts cell wall synthesis, causing morphological defects and activating the σᴹ stress response. This highlights its essentiality in maintaining envelope integrity .

B. Antibiotic Development

UppP is a validated target for novel antibiotics. Inhibitors blocking UP synthesis could circumvent resistance mechanisms seen in methicillin-resistant Staphylococcus aureus (MRSA) and vancomycin-resistant Enterococci (VRE) .

C. Ecological Adaptations

In P. vibrioformis, uppP supports survival in low-sulfide marine environments by optimizing peptidoglycan synthesis under fluctuating redox conditions .

Technical Considerations for Experimental Use

  • Storage Stability: Lyophilized uppP retains activity for 12 months at -80°C, while liquid forms last 6 months .

  • Activity Assays: Enzymatic activity is measured via phosphate release from UPP, often coupled with malachite green detection .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uppP; Cvib_0492; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Chlorobium phaeovibrioides (strain DSM 265 / 1930) (Prosthecochloris vibrioformis (strain DSM 265))
Target Names
uppP
Target Protein Sequence
MTLFEAIMLGIVQGLTEFLPISSTAHLKIVPALLGWSDPGAAFTAIIQIGTLAAVLMYFW RDIITIVSAVMKGILKGKPLESNEARMGWMIAAGTIPIVVFGLLFKDQIETTLRSLYWIS GALIGLALLLSLAEWNIKKHLSGGRPLKTMEQIGWKEALLIGLAQSIALIPGSSRSGVTI TGGLFLNLSRETAARFSFLLSLPAVFAAGIFQLYKTWDIITASPGNIMNLAAATFTSAVV GYLSIAFLLSYLKKHTTTIFIIYRLLAGILLLLLLSTGTLLP
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prosthecochloris vibrioformis Undecaprenyl-diphosphatase (uppP) and why is it important?

Undecaprenyl-diphosphatase (UppP) is an essential enzyme that dephosphorylates undecaprenyl pyrophosphate (UPP) to generate undecaprenyl phosphate (UP), also known as bactoprenol, lipid-P, or C55-P. This conversion is critical for bacterial cell wall synthesis, as UP serves as the lipid carrier for peptidoglycan precursors across the cytoplasmic membrane .

In Prosthecochloris vibrioformis, a species of green sulfur bacteria capable of anoxygenic photosynthesis and nitrogen fixation , UppP likely plays a similar essential role in cell envelope maintenance. Like other bacteria, P. vibrioformis requires proper cell envelope synthesis to maintain cellular integrity and function in its ecological niches, which include hydrogen sulfide-rich environments and coral skeletons .

The study of UppP from P. vibrioformis is particularly valuable because:

  • It represents an essential process in a photosynthetic bacterium with unique ecological adaptations

  • Understanding UppP function contributes to our knowledge of bacterial cell wall synthesis diversity

  • Bacterial UPP phosphatases are potential antibiotic targets as demonstrated in other species

How does Prosthecochloris vibrioformis UppP compare to similar enzymes in other bacteria?

While specific data on P. vibrioformis UppP is limited, we can draw comparisons with better-characterized UPP phosphatases:

OrganismEnzymeKey CharacteristicsEcological ContextCitation
Bacillus subtilisUppPEssential function (with BcrC); σM-dependent regulationSoil bacterium
Bacillus subtilisBcrCRedundant with UppP; bacitracin resistanceSoil bacterium
Prosthecochloris vibrioformisUppPPresumed essential; detailed characterization pendingHydrogen sulfide-rich environments, coral skeletons

In B. subtilis, UppP and BcrC show functional redundancy, with either enzyme sufficient to support growth . Whether P. vibrioformis exhibits similar redundancy remains to be determined, though this characteristic may differ given its distinct evolutionary history as a green sulfur bacterium.

What are the predicted structural features of P. vibrioformis UppP?

Based on homology with characterized UPP phosphatases, P. vibrioformis UppP likely contains:

  • Multiple transmembrane domains that anchor it within the cytoplasmic membrane

  • Active site residues positioned to access the pyrophosphate group of UPP

  • Conserved catalytic residues involved in phosphate hydrolysis

Researchers should consider performing structural predictions using bioinformatics tools and homology modeling based on crystal structures of related phosphatases to guide experimental design.

How should researchers design experiments to express recombinant P. vibrioformis UppP?

When designing expression experiments for recombinant P. vibrioformis UppP, researchers should consider the following methodological approach:

Independent Variable (IV): Expression system/conditions (e.g., E. coli BL21(DE3), C41(DE3), or other hosts specialized for membrane proteins)

Dependent Variable (DV): Yield of functional UppP protein (measured in mg/L of culture)

Controlled Variables:

  • Growth temperature before induction

  • Media composition

  • Cell density at induction

Constants:

  • Gene sequence (codon-optimized for the host)

  • Affinity tag position and composition

Experimental Procedure:

  • Clone the P. vibrioformis uppP gene into multiple expression vectors with different promoters (T7, tac, ara) and fusion tags

  • Transform vectors into various E. coli strains specialized for membrane protein expression

  • Test multiple expression conditions (temperature, inducer concentration, induction time)

  • Harvest cells and prepare membrane fractions

  • Quantify expression levels by Western blotting and measure enzyme activity

Data Collection and Analysis:
Create a data table similar to the one below to systematically record results:

Expression SystemInduction Temperature (°C)Inducer ConcentrationInduction Time (h)Yield (mg/L)Activity (units/mg)
BL21(DE3), pET28a160.1 mM IPTG16
BL21(DE3), pET28a250.1 mM IPTG4
C41(DE3), pET28a160.1 mM IPTG16
C43(DE3), pET28a160.1 mM IPTG16

This experimental design follows proper methodology by clearly defining variables, controlling potential confounding factors, and establishing a systematic data collection approach .

What assays can be used to measure the activity of recombinant P. vibrioformis UppP?

Researchers have several methodological options for assaying UppP activity:

  • Radiolabeled substrate assay

    • Use 32P-labeled UPP as substrate

    • Measure release of inorganic phosphate by thin-layer chromatography or scintillation counting

    • Advantage: High sensitivity and direct measurement of enzyme activity

    • Limitation: Requires radioactive materials and specialized facilities

  • Colorimetric phosphate detection

    • Use synthetic UPP substrate

    • Measure released phosphate using malachite green or other phosphate-detection reagents

    • Advantage: Non-radioactive, relatively straightforward

    • Limitation: Lower sensitivity than radioactive assays

  • Coupled enzyme assay

    • Link UppP activity to another enzymatic reaction that generates a detectable product

    • Measure the rate of the coupled reaction spectrophotometrically

    • Advantage: Continuous monitoring of activity

    • Limitation: Potential interference from coupling enzymes

When designing activity assays, researchers should consider the following variables:

Independent Variables:

  • Substrate concentration (varied to determine Km and Vmax)

  • pH

  • Temperature

  • Potential inhibitors

Dependent Variable:

  • Rate of UPP dephosphorylation (nmol/min/mg protein)

Controls:

  • Heat-inactivated enzyme (negative control)

  • Known UPP phosphatase from another organism (positive control)

How can researchers investigate the physiological role of UppP in P. vibrioformis?

Investigating the physiological role requires a multifaceted approach:

  • Gene disruption studies

    • Use CRISPR interference (CRISPRi) with catalytically inactive ("dead") CRISPR-associated protein 9 (dCas9)-based transcriptional repression to study the effects of UppP depletion

    • Examine phenotypic changes, particularly in cell morphology and envelope integrity

    • Determine whether functional redundancy exists (as in B. subtilis) by simultaneously targeting potential redundant phosphatases

  • Complementation experiments

    • Express recombinant P. vibrioformis UppP in bacteria with UPP phosphatase deficiencies

    • Determine if P. vibrioformis UppP can functionally replace the native enzyme

  • Stress response analysis

    • Examine whether UppP depletion activates cell envelope stress responses, similar to the σM-dependent response observed in B. subtilis

    • Measure expression of genes involved in cell envelope homeostasis

  • Ecological context investigation

    • Determine if UppP expression or activity varies under different environmental conditions relevant to P. vibrioformis habitats (e.g., different sulfide concentrations, light conditions, or in association with coral)

What approaches can be used to identify inhibitors of P. vibrioformis UppP?

Researchers interested in identifying inhibitors should consider these methodological approaches:

  • High-throughput screening

    • Develop a miniaturized version of the UppP activity assay

    • Screen compound libraries for inhibitory activity

    • Validate hits with dose-response curves and secondary assays

  • Structure-based drug design

    • Generate a structural model of P. vibrioformis UppP based on homologous proteins

    • Perform in silico docking studies to identify potential inhibitors

    • Synthesize and test the most promising candidates

  • Natural product screening

    • Test extracts from microorganisms that compete with P. vibrioformis in its natural habitats

    • Bioassay-guided fractionation to identify active compounds

  • Comparative analysis with known inhibitors

    • Test whether known inhibitors of UPP phosphatases, such as bacitracin (which binds to UPP rather than the enzyme directly) , are effective against P. vibrioformis UppP

    • Determine structure-activity relationships to develop more selective inhibitors

For inhibitor studies, researchers should construct inhibition profiles using this data table format:

InhibitorIC50 (μM)Ki (μM)Inhibition TypeSelectivity Ratio*
Compound A
Compound B
Bacitracin

*Selectivity ratio = IC50 against human phosphatases/IC50 against P. vibrioformis UppP

How can researchers address common challenges in recombinant expression of P. vibrioformis UppP?

As a membrane protein, UppP presents several expression challenges:

  • Low expression levels

    • Methodological solution: Optimize codon usage for the expression host

    • Test different promoter strengths and ribosome binding sites

    • Evaluate expression in specialized strains like C41/C43(DE3) designed for membrane proteins

    • Consider adding molecular chaperones to assist proper folding

  • Protein aggregation/inclusion body formation

    • Methodological solution: Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Express as a fusion with solubility-enhancing partners (MBP, SUMO, etc.)

    • Screen different detergents for solubilization if inclusion bodies form

  • Low activity of purified protein

    • Methodological solution: Optimize buffer conditions (pH, salt, glycerol)

    • Add stabilizing agents during purification

    • Test reconstitution into lipid vesicles to provide a native-like membrane environment

    • Verify protein folding using biophysical techniques like circular dichroism

How should researchers analyze and interpret contradictory results in UppP studies?

When facing contradictory results:

  • Systematic comparison of experimental conditions

    • Create a detailed table comparing all experimental variables between contradictory experiments

    • Identify subtle differences that might explain discrepancies

  • Independent verification

    • Have multiple researchers reproduce the experiments

    • Use alternative methods to measure the same parameters

  • Cross-species comparisons

    • Compare results with UppP from related species

    • Determine if contradictions reflect genuine biological differences or experimental artifacts

  • Integration with genomic context

    • Analyze the genomic environment of uppP in P. vibrioformis

    • Determine if genetic differences might explain functional differences compared to other species

How might research on P. vibrioformis UppP contribute to understanding bacterial adaptation to specialized habitats?

P. vibrioformis occupies unique ecological niches including coral skeletons , raising interesting questions about potential specialized features of its cell envelope maintenance machinery:

  • Comparative genomics approaches

    • Compare UppP sequences and genetic context between coral-associated and non-coral-associated Prosthecochloris strains

    • Identify signature adaptations in cell envelope-related genes

  • Environmental response studies

    • Investigate how UppP activity changes under conditions mimicking the coral skeleton environment

    • Determine if UppP expression or regulation differs between free-living and coral-associated states

  • Interaction studies

    • Examine potential interactions between UppP and other proteins unique to P. vibrioformis

    • Investigate whether UppP activity is modulated by molecules present in the coral environment

This research direction would contribute to our understanding of how fundamental bacterial processes adapt to specialized ecological contexts, potentially revealing novel mechanisms of bacterial-host interactions in coral ecosystems .

What are the prospects for developing selective inhibitors targeting bacterial UPP phosphatases?

The essential nature of UPP phosphatases makes them attractive antibiotic targets . Research on P. vibrioformis UppP could contribute to this field by:

  • Identifying unique structural features

    • Compare structural models of UppP across diverse bacterial phyla

    • Identify features unique to specific bacterial groups that could be selectively targeted

  • Resistance mechanism studies

    • Determine how bacteria might develop resistance to UppP inhibitors

    • Study natural variations in UppP that confer resistance to compounds like bacitracin

  • Multi-target approaches

    • Investigate synergistic effects of targeting UppP along with other cell envelope synthesis enzymes

    • Develop combination strategies to minimize resistance development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.