Recombinant Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Protease HtpX (htpX) is a zinc-dependent metalloprotease originally identified in Escherichia coli and engineered for enhanced stability and activity through recombinant DNA technology. It participates in protein quality control by degrading misfolded membrane proteins in conjunction with ATP-dependent proteases like FtsH . This enzyme has garnered attention for its roles in bacterial stress response, antibiotic resistance mechanisms, and biotechnological applications . Below, we synthesize structural, biochemical, and functional insights from diverse studies to provide a comprehensive overview of Recombinant Protease HtpX.

Biochemical Properties

Recombinant HtpX exhibits unique biochemical traits:

PropertyDetails
Metal dependenceRequires Zn²⁺ for activity; inhibited by chelators (e.g., EDTA) .
Substrate specificityCleaves cytoplasmic regions of membrane proteins (e.g., SecY) and casein .
Optimal pHActivity peaks at pH 7.0–8.0 .
Self-degradationRapid autoproteolysis occurs upon membrane solubilization unless mutated .

4.1. Proteolytic Activity and Substrate Cleavage

  • Recombinant HtpX degrades SecY, a membrane protein involved in protein translocation, both in vitro and in vivo .

  • Caseinolytic activity is observed in refolded Zn²⁺-supplemented HtpX, confirming its broad substrate range .

4.2. Role in Antibiotic Resistance

In Stenotrophomonas maltophilia, HtpX and ClpA proteases jointly mitigate aminoglycoside (AG)-induced protein stress. Double deletion mutants (ΔClpAΔHtpX) show marked AG hypersensitivity :

StrainMIC (µg/mL)
Wild-type128 (kanamycin)
ΔClpAΔHtpX4 (kanamycin)
ΔClpPΔHtpX128 (kanamycin)

This highlights HtpX as a potential target for AG adjuvant therapies .

4.3. In Vivo Protease Activity Assay

A novel assay using engineered substrates enabled semiquantitative measurement of HtpX activity in live cells, facilitating functional studies of conserved residues (e.g., E140A) .

5.1. Expression Systems

  • E. coli BL21(DE3): Yields ~2 mg/L of His8-tagged HtpX after cobalt-affinity, anion-exchange, and size-exclusion chromatography .

  • Bacillus subtilis WB800N: Achieves 61.9-fold higher fermentation levels than native htpX-expressing strains .

5.2. Purification Challenges

  • Self-degradation: Addressed using catalytically inactive mutants (e.g., E140A) and denaturing refolding protocols .

  • Detergent optimization: Octyl-β-D-glucoside maintains HtpX stability during membrane extraction .

Applications and Future Directions

  • Industrial proteases: Engineered Bacillus subtilis strains produce Recombinant HtpX for applications in detergent and feed industries .

  • Drug discovery: Targeting HtpX could potentiate existing antibiotics by disrupting bacterial protein quality control .

  • Structural studies: Purification advances enable crystallographic efforts to resolve HtpX’s mechanism .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we can accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your preferred tag.
Synonyms
htpX; XF_2625; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Xylella fastidiosa (strain 9a5c)
Target Names
htpX
Target Protein Sequence
MLTRIVLFAITNLAVLILASIVMSLLGVNPTQMSGLLVMALIFGFAGSFISLLMSKAIAK RTTGAYVIDQPRNLSERWLLDTVSRQAEIVGIGRPEIAIYEGVEINAFATGADRNNALVA VSTGLLQNMSQDEVEAVLGHEIAHVANGDMVTMALLQGVLNTFVIVLARVVGGFIDSLLS GNRGGARGVAYYAIVLVLELLFGLFATMITMWFSRRREFRADEGGAYLAGRNKMIAALER LGINHGQSTLPTQVQAFGIYGGIGEGLRKLFLSHPPLSERIAALRVARQ
Uniprot No.

Target Background

Database Links

KEGG: xfa:XF_2625

STRING: 160492.XF2625

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and what are its key characteristics?

HtpX is a membrane-bound zinc metalloprotease that participates in the proteolytic quality control of membrane proteins. In Escherichia coli, it functions in conjunction with FtsH, a membrane-bound and ATP-dependent protease . The complete htpX gene coding sequence is 909 bp, encoding a protein of 290 amino acid residues with no signal peptide . Structural analysis shows that htpX contains 203 amino acid peptidase M48 domains (residues 87-289) and metalloprotease (zincin) catalytic domains that are critical for its function .

For researchers studying htpX, it's important to note that the protein is neutral and heat-resistant, with optimal activity at pH 7 and 45°C. The enzyme maintains over 90% activity when stored at 50°C for 8 hours, making it relatively stable for experimental work . This stability profile distinguishes it from many other proteases and makes it valuable for various research applications.

How does recombinant htpX differ from native htpX in terms of activity and stability?

Recombinant htpX demonstrates significantly enhanced activity compared to native forms. For example, the DX-3-htpX recombinant protease exhibits a fermentation activity of 135.68 ± 3.66 U/mL, which represents a 61.9-fold increase compared to the native DX-3 protease (2.19 ± 0.28 U/mL) . This dramatic improvement in activity makes the recombinant form particularly valuable for research applications requiring higher enzymatic efficiency.

While both native and recombinant forms share the same optimal reaction temperature (45°C) and pH (7), the recombinant DX-3-htpX protease demonstrates improved high-temperature resistance and pH tolerance compared to the native DX-3 protease . This enhanced stability is advantageous for experimental procedures requiring prolonged incubation periods or challenging reaction conditions.

What is the relationship between htpX and other proteolytic systems in bacterial cells?

HtpX operates as part of an integrated proteolytic quality control system in bacteria, working in conjunction with FtsH, another membrane-bound protease . This coordination is important for maintaining membrane protein homeostasis. When designing experiments involving htpX, researchers should consider that it represents one component of a complex proteolytic network rather than an isolated enzyme.

In E. coli, htpX has been confirmed to cleave membrane proteins such as SecY, both in vitro with solubilized membrane preparations and in vivo when both htpX and SecY are overproduced . This demonstrates its functional role in membrane protein degradation and quality control. Research exploring htpX should consider potential interactions with other proteolytic systems that might influence experimental outcomes.

What are the recommended methods for cloning and expressing recombinant htpX?

For successful cloning and expression of recombinant htpX, researchers should consider the following methodological approach:

  • Gene Amplification: Design primers containing appropriate restriction sites (e.g., BamHI and SmaI) based on the gene sequence. For DX-3-htpX, successful primers included P1:5′-CGGATCCTGCTGCTAAAACATTCACTGTT-3′ and P2:5′-TCCCCGGGTTTATAGGAATGCAAGCGC-3′ .

  • Vector Selection: The pHT43 expression vector has been successfully used for htpX expression. After PCR amplification, digest both the PCR product and vector with appropriate restriction enzymes (BamHI and SmaI), followed by ligation with T4 ligase .

  • Transformation Strategy: A two-step transformation process is recommended. First transform into E. coli DH5α for plasmid verification and amplification, then into E. coli BL21(DE3) to improve transformation efficiency, before final electro-transformation into Bacillus subtilis WB800N for expression .

  • Expression Conditions: Culture the engineering strain (e.g., WB800N/pHT43-htpX) in LB medium with appropriate antibiotics (Cm at 10 μg/mL) to OD600 ≈ 0.6–0.8, then induce with IPTG at a final concentration of 1 mM .

  • Protein Recovery: Centrifuge cultures and collect the supernatant for SDS-PAGE analysis and enzyme activity testing .

This methodological approach has been proven to yield significant increases in htpX expression and activity, with the recombinant enzyme showing substantially higher fermentation levels compared to native forms .

What purification challenges are associated with htpX and how can they be overcome?

Purifying htpX presents significant challenges due to its self-degradation properties and membrane association. Key challenges and solutions include:

  • Self-degradation Issue: HtpX undergoes self-degradation upon cell disruption or membrane solubilization, complicating traditional purification approaches .

  • Denaturing Purification Method: To overcome self-degradation, purify htpX under denaturing conditions. This approach has been successfully implemented in research studies .

  • Refolding Protocol: After purification under denaturing conditions, refold the protein in the presence of a zinc chelator to preserve its structure. This is crucial as zinc supplementation will later be required for activity .

  • Activity Restoration: Following refolding, supplement with Zn²⁺ to restore enzymatic activity. This is essential as htpX is a zinc-dependent metalloprotease .

  • Verification of Activity: Confirm successful purification and refolding by testing self-cleavage activity and ability to degrade model substrates such as casein or solubilized membrane proteins like SecY .

This methodological approach allows researchers to obtain active htpX despite its challenging biochemical properties. The purification strategy addresses the central challenge of self-degradation while maintaining the ability to restore enzymatic activity through appropriate metal ion supplementation.

How should enzymatic assays be designed to accurately measure htpX activity?

Designing enzymatic assays for htpX requires careful consideration of its optimal reaction conditions and substrate specificity. A methodological approach should include:

  • Temperature Optimization: Conduct assays at 45°C, which has been identified as the optimal reaction temperature for htpX activity. At this temperature, enzyme activity can be doubled compared to 30°C .

  • pH Conditions: Maintain a neutral pH (pH 7) for optimal activity. Buffer solutions should be carefully selected as enzyme activity is significantly higher within the pH 7–9 range .

  • Cofactor Supplementation: Include Zn²⁺ in reaction mixtures, as htpX is a zinc-dependent metalloprotease and requires this cofactor for activity .

  • Substrate Selection: Multiple substrate options exist:

    • Casein has been successfully used for general proteolytic activity measurement

    • For more specific analysis, solubilized membrane proteins (particularly SecY) can be used as substrates

  • Assay Duration and Sampling: For time-course studies, consider the enzyme's stability. Activity preservation rate remains over 90% at 50°C for up to 8 hours, allowing for extended assay times if needed .

  • Controls: Include non-induced samples as negative controls when working with recombinant htpX to validate that the observed activity is specifically from the induced protease .

All experiments should be conducted in triplicate, with results reported as mean values ± standard deviation to ensure statistical reliability .

How does the 3D structure of htpX relate to its proteolytic function?

The 3D structure of htpX provides critical insights into its proteolytic mechanism. AlphaFold3 predictions of the DX-3-htpX protease structure reveal a complex architecture consisting of ten α-helixes, four strands, two 310 helixes, twelve turns, seven bends, and multiple coil regions . This structural arrangement creates the active site that facilitates its proteolytic function.

The functional core of htpX contains the M48 peptidase domain and metalloprotease (zincin) catalytic domains that are essential for its proteolytic activity . Research has identified specific active sites within the D3 pocket that interact with substrates, including residues such as ARG4, LEU7, PHE8, VAL11, and many others as detailed in the table below :

ProteaseArea (Ų)Volume (ų)Active Sites in the D3 Pocket
HtpX557.472837.241ARG4, LEU7, PHE8, VAL11, ALA52, SER55, LEU56, SER59, MET62, ALA63, TRP65, MET66, MET67, ASN113, ALA114, PHE115, ALA116, THR117, GLY118, MET132, VAL144, HIS147, GLU148, HIS151, MET157, THR160, THR161, LEU162, GLN164, ILE214, HIS217, SER218, ARG221, GLU222, MET238, ALA241, LEU242, LEU254, THR276, HIS277, ARG283

These structural features explain why htpX functions as an endoprotease and provides a foundation for understanding substrate specificity and the effects of various conditions on enzymatic activity.

How do metal ions influence htpX structure and activity?

Metal ions play a crucial role in modulating both the structure and activity of htpX. Research using CASTpFold analysis has demonstrated that different metal ions significantly alter the 3D structure and active sites of the protease . The binding of Ca²⁺, Zn²⁺, Cl⁻, and K⁺ to htpX can change the conformation and size of the active pocket.

Quantitative structural analysis reveals these specific impacts:

ProteaseArea (Ų)Volume (ų)Active Sites in the D3 Pocket
HtpX557.472837.24141 active sites (see complete list in section 3.1)
HtpX-Ca²⁺918.1541378.22138 active sites including LEU1, LYS3, ALA110, GLU111, VAL112, ASN113, ALA114, MET132, etc.
HtpX-Cl⁻714.286867.36439 active sites including LEU1, LYS3, GLU111, VAL112, ASN113, ALA114, MET132, etc.
HtpX-K⁺925.5441335.23743 active sites including LEU1, LEU2, LYS3, ALA110, GLU111, VAL112, ASN113, etc.
HtpX-Zn²⁺811.0231179.12739 active sites including LEU1, LEU2, LYS3, ALA110, GLU111, VAL112, etc.

Among these ions, Ca²⁺ binding helps create the largest active pocket (1378.221 ų compared to the native 837.241 ų) . This structural modification likely enhances substrate accessibility and may contribute to increased catalytic efficiency.

Zn²⁺ deserves special attention as htpX is specifically characterized as a zinc-dependent metalloprotease. Biochemical studies have confirmed that supplementation with Zn²⁺ is required for the purified enzyme to exhibit self-cleavage activity and to degrade substrates like casein and SecY .

What is the substrate specificity of htpX and how can it be experimentally determined?

HtpX demonstrates substrate specificity that reflects its biological role in membrane protein quality control. Experimental evidence indicates that it can cleave both soluble proteins like casein and membrane proteins such as SecY . This dual specificity makes it an interesting subject for protease research.

To experimentally determine htpX substrate specificity, researchers should consider the following methodological approach:

  • In vitro proteolysis assays: Test purified htpX against different potential substrates under optimized conditions (45°C, pH 7, with Zn²⁺ supplementation). Analyze cleavage patterns using SDS-PAGE and/or Western blotting .

  • Membrane protein specificity: For investigating specificity toward membrane proteins, solubilize membrane fractions using appropriate detergents before incubation with purified htpX. This approach has successfully demonstrated htpX activity against SecY .

  • In vivo verification: Confirm in vitro findings by overexpressing both htpX and potential substrate proteins in vivo and monitoring substrate degradation. This approach successfully verified SecY as a physiological substrate .

  • Cleavage site determination: For detailed substrate specificity, identify cleavage sites using techniques such as N-terminal sequencing or mass spectrometry of proteolytic fragments.

  • Structure-based prediction: Utilize the 3D structural model of htpX to predict potential substrate binding sites and interactions. The D3 pocket analysis provides valuable information about the active site architecture that may influence substrate recognition .

When analyzing experimental results, researchers should consider that htpX activity may be influenced by specific metal ions that modify the active site pocket dimensions and configuration, potentially altering substrate specificity .

How can recombinant htpX be optimized for specific research applications?

Optimizing recombinant htpX for specific research applications involves strategic modifications that enhance desired properties while maintaining essential functionality. Key methodological approaches include:

  • Expression System Selection: Choose between E. coli BL21(DE3) for initial transformations and B. subtilis WB800N for final expression. The B. subtilis system has demonstrated high expression levels (135.68 ± 3.66 U/mL) compared to native sources (2.19 ± 0.28 U/mL) .

  • Codon Optimization: Adapt the htpX gene sequence to the codon usage bias of the expression host to potentially increase translation efficiency and protein yield.

  • Metal Ion Supplementation Strategy: Different metal ions (Ca²⁺, Zn²⁺, K⁺, Cl⁻) create varying active pocket sizes and potentially different substrate specificities . Select specific ions based on your research needs:

    • For largest active pocket: Supplement with Ca²⁺ (increases pocket volume to 1378.221 ų)

    • For essential catalytic activity: Ensure Zn²⁺ availability (increases pocket volume to 1179.127 ų)

  • Temperature and pH Optimization: While the optimal temperature is generally 45°C and optimal pH is 7, fine-tune these parameters based on specific application requirements . The enzyme maintains significant activity across pH 7-9 and demonstrates impressive temperature stability (>90% activity after 8 hours at 50°C).

  • Fusion Protein Strategies: Consider creating fusion constructs with affinity tags that facilitate purification while minimizing impact on enzymatic activity. Position tags carefully to avoid interfering with the M48 peptidase domain (residues 87-289) .

When optimizing for specific applications, researchers should conduct validation experiments comparing activity of the optimized enzyme against the standard recombinant form to ensure modifications enhance rather than compromise desired functions.

What experimental design considerations are important when studying htpX in membrane protein quality control?

Studying htpX's role in membrane protein quality control requires carefully designed experiments that address its unique characteristics and cellular context. Consider these methodological approaches:

Researchers should design experiments with appropriate controls to distinguish between direct effects of htpX activity and indirect consequences through other cellular pathways. When overexpressing htpX, consider potential artifacts from non-physiological expression levels.

How can structural data be integrated with functional analysis to advance htpX research?

Integrating structural and functional data provides powerful insights into htpX biology. Researchers can implement this integrated approach using these methodological strategies:

  • Structure-Guided Mutagenesis:

    • Target specific residues in the active site based on 3D models (e.g., residues in the D3 pocket)

    • Create systematic mutations of key residues identified in structural models

    • Test mutant proteins for altered activity, substrate specificity, or metal ion responses

  • Metal Ion Influence Analysis:

    • Based on structural data showing different active pocket configurations with various ions , design experiments to test functional consequences

    • Compare enzymatic parameters (Km, Vmax) of htpX in the presence of different metal ions

    • Correlate pocket size changes with catalytic efficiency for different substrates

  • Domain Function Investigation:

    • The M48 peptidase domain (residues 87-289) is critical for htpX function

    • Design truncated or chimeric proteins to isolate domain-specific functions

    • Test domain-specific inhibitors based on structural predictions

  • Computational Modeling Integrated with Experimental Validation:

    • Use 3D structural data to perform in silico docking studies with potential substrates

    • Generate hypotheses about binding modes and cleavage sites

    • Verify predictions through experimental approaches like site-directed mutagenesis

  • Conformational Dynamics Analysis:

    • Investigate how metal binding induces conformational changes using techniques like hydrogen-deuterium exchange

    • Correlate structural changes with altered catalytic parameters

This integrated approach allows researchers to move beyond descriptive studies to mechanistic understanding of htpX function. When implementing this strategy, ensure that structural predictions (e.g., from AlphaFold3) are validated experimentally, and that functional studies are interpreted in the context of the enzyme's known structural features.

What are the key considerations when investigating htpX interactions with other proteolytic systems?

HtpX functions within a complex network of proteolytic systems, particularly in conjunction with FtsH . Investigating these interactions requires careful experimental design:

  • Genetic Interaction Analysis:

    • Create single and double mutants (htpX, FtsH, and htpX/FtsH)

    • Perform synthetic genetic array analysis to identify additional genetic interactions

    • Quantify phenotypic effects under various stress conditions

  • Substrate Competition Studies:

    • Identify substrates processed by both htpX and other proteases

    • Design in vitro competition assays with purified proteases

    • Analyze cleavage patterns to determine preferential processing

  • Temporal Regulation Investigation:

    • Study expression patterns of htpX and related proteases under different conditions

    • Use time-course experiments to determine sequential activation

    • Implement inducible systems to control relative expression timing

  • Spatial Distribution Analysis:

    • Determine subcellular localization of htpX and interacting proteases

    • Investigate co-localization patterns using fluorescent tagging or immunolocalization

    • Consider membrane microdomain organization and its impact on proteolytic function

  • Biochemical Interaction Studies:

    • Perform co-immunoprecipitation to identify physical interactions

    • Use cross-linking approaches to capture transient interactions

    • Consider native PAGE or size exclusion chromatography to detect complex formation

  • Systems Biology Approach:

    • Implement proteome-wide studies comparing wild-type and protease-deficient strains

    • Use quantitative proteomics to identify substrates affected by multiple proteases

    • Develop computational models of the integrated proteolytic network

When designing these experiments, researchers should be aware that htpX may have both overlapping and distinct functions compared to other proteases. Careful control experiments are essential to distinguish between direct and indirect effects in complex proteolytic networks.

How can researchers address issues with htpX stability during experimental procedures?

HtpX presents significant stability challenges, particularly its tendency for self-degradation upon cell disruption or membrane solubilization . Researchers can implement these methodological solutions:

  • Denaturing Purification Strategy:

    • Purify htpX under denaturing conditions to prevent self-degradation

    • Use 6M urea or 8M guanidine hydrochloride as denaturing agents

    • Implement rapid purification protocols to minimize exposure time

  • Protease Inhibitor Approach:

    • Add appropriate protease inhibitors immediately upon cell lysis

    • For zinc metalloproteases like htpX, include specific inhibitors like 1,10-phenanthroline

    • Consider cocktails specifically designed for membrane proteins

  • Controlled Refolding Procedure:

    • Refold denatured htpX in the presence of a zinc chelator to prevent premature activation

    • Use step-wise dialysis to gradually remove denaturants

    • Optimize buffer conditions (pH, salt concentration) for stability

  • Storage Optimization:

    • Store purified protein at appropriate temperature (consider -80°C for long-term)

    • Add glycerol (10-20%) to prevent freeze-thaw damage

    • Aliquot samples to avoid repeated freeze-thaw cycles

  • Activity Preservation:

    • For experiments requiring native conditions, work at pH 6-7 where enzyme activity preservation is highest after 8 hours

    • Keep temperature below 50°C for extended work periods, as activity drops significantly at higher temperatures

When troubleshooting stability issues, researchers should systematically test different conditions and additives, maintaining careful documentation of stability under each condition. Remember that structural modification by different metal ions may also influence stability profiles .

What are the key challenges in interpreting htpX activity data and how can they be overcome?

Interpreting htpX activity data presents several challenges due to its complex biochemical properties and interactions. Researchers can address these challenges through:

  • Control for Metal Ion Effects:

    • Different metal ions (Ca²⁺, Zn²⁺, K⁺, Cl⁻) significantly alter the active site pocket dimensions and potentially activity profiles

    • Run parallel assays with different metal ions to establish a complete activity profile

    • Report which metal ions were present in all activity assays

  • Substrate Specificity Considerations:

    • HtpX cleaves both soluble (casein) and membrane proteins (SecY)

    • Include multiple substrate types in activity assessments

    • Consider that apparent activity differences may reflect substrate preference rather than absolute activity

  • Self-Cleavage Interference:

    • Account for htpX self-degradation when measuring activity over time

    • Include self-degradation controls to distinguish between reduced activity and enzyme loss

    • Consider shorter incubation times or conditions that minimize self-degradation

  • Expression System Variables:

    • Different expression systems yield dramatically different activity levels (native vs. recombinant)

    • Clearly specify the source and expression system when reporting activity data

    • Consider normalizing to protein concentration rather than reporting only raw activity

  • Standardized Activity Measurements:

    • Report activity in standard units (U/mL) with clear definition of what constitutes one unit

    • Perform assays in triplicate and report mean values with standard deviation

    • Include positive controls with known activity levels for comparison

When publishing htpX activity data, researchers should provide comprehensive methodological details including buffer composition, metal ion concentration, temperature, pH, and incubation time to enable proper interpretation and reproducibility.

What emerging technologies might advance understanding of htpX structure and function?

Several cutting-edge technologies hold promise for deepening our understanding of htpX biology:

  • Advanced Structural Determination Methods:

    • Cryo-electron microscopy (cryo-EM) for membrane-associated htpX in near-native states

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to analyze conformational dynamics

    • Microcrystal electron diffraction (MicroED) for structural analysis of small crystals

    • Advanced NMR techniques for dynamic structural elements

  • High-throughput Substrate Identification:

    • TAILS (Terminal Amine Isotopic Labeling of Substrates) proteomics for systematic identification of cleavage sites

    • Proximity-dependent biotin identification (BioID) to identify proteins in close proximity to htpX

    • Degradomics approaches to catalog all potential cellular substrates

  • Advanced Computational Methods:

    • Artificial intelligence beyond AlphaFold3 for modeling dynamic structural changes

    • Molecular dynamics simulations to understand metal ion effects on structure

    • Quantum mechanics/molecular mechanics (QM/MM) approaches for catalytic mechanism elucidation

  • Single-Molecule Techniques:

    • Single-molecule FRET to observe conformational changes during substrate binding

    • Optical tweezers to measure forces during substrate processing

    • Nanopore analysis for real-time monitoring of proteolytic events

  • In-cell Structural Biology:

    • In-cell NMR to study htpX structure in its native environment

    • Correlative light and electron microscopy (CLEM) to visualize htpX location and activity

    • Super-resolution microscopy to track htpX dynamics in membranes

Researchers implementing these technologies should consider interdisciplinary collaborations to leverage specialized expertise and equipment. Integration of multiple advanced approaches will likely yield the most comprehensive insights into htpX biology.

How might understanding of htpX inform broader research on membrane protein quality control?

HtpX research has significant implications for the broader field of membrane protein quality control, with potential methodological impacts including:

  • Integrated Proteolytic Network Modeling:

    • HtpX works cooperatively with FtsH in membrane protein quality control

    • Study of this relationship provides a model for investigating other cooperative protease systems

    • Develop systems biology approaches to model complete proteolytic networks

  • Membrane Protein Degradation Mechanisms:

    • HtpX's ability to cleave membrane proteins like SecY informs general principles of membrane protein degradation

    • Apply htpX research methodologies to study other membrane proteases

    • Develop standard assays for membrane protein degradation based on htpX protocols

  • Stress Response Integration:

    • Investigate how htpX and related proteases respond to specific cellular stresses

    • Develop comprehensive models of stress response mechanisms

    • Create predictive frameworks for membrane protein quality control under various conditions

  • Therapeutic Target Identification:

    • Apply knowledge of bacterial htpX to identify similar mechanisms in pathogens

    • Develop potential inhibitors based on structural insights

    • Screen for compounds that modulate proteolytic networks rather than single proteases

  • Biotechnological Applications:

    • Utilize htpX's heat resistance and neutral pH optimum for specialized applications

    • Engineer modified htpX with enhanced stability or altered specificity

    • Develop expression systems optimized for membrane protease production

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.