Recombinant Protease rseP (rseP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
rseP; YPO1051; y3128; YP_2799; Protease RseP; S2P endopeptidase; Site-2 protease RseP; S2P protease RseP; Site-2-type intramembrane protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Yersinia pestis
Target Names
rseP
Target Protein Sequence
MMSILWSLAAFIVALGILITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRQGTEYV IALIPLGGYVKMLDERVEAVAPELRHQSFNNKTVLQRAAIVSAGPIANFLFAIVAYWLVF IIGVPSVRPVIGDISPQSIAAQANISSGMELKSVDGIETPDWDSVRLALISRIGDKQMQV GVAPFGSDNVVEKTLDLRQWQFEPDKQDPVVALGIIPRGPQIESVLAEVQPGSAAQKAGL QAGDRIVKVNGQLLDRWQTFVLQVRDNPGQPLVLDIERESTPLSLTLIPDTKSVGENRSE GFAGVVPKVIPLPDEYKTIRQYGPFTAVYQAGDKTWQLMRLTVSMLGKLITGDVKLNNLS GPISIAQGAGLSAEYGLVYYLMFLALISVNLGIINLFPLPVLDGGHLLFLAIEKLKGGPV SERVQDFSYRIGSILLVLLMGLALFNDFSRL
Uniprot No.

Target Background

Function

Recombinant rseP is a site-2 regulated intramembrane protease (S2P) that cleaves the peptide bond between Ala-108 and Cys-109 within the transmembrane domain of RseA. It participates in a regulated intramembrane proteolysis (RIP) cascade. Specifically, rseP acts on DegS-cleaved RseA, releasing the cytoplasmic domain of RseA. This proteolytic event activates sigma-E (RpoE) cellular signaling.

Database Links

KEGG: ype:YPO1051

STRING: 187410.y3128

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is RseP and what is its primary function in E. coli?

RseP (formerly known as YaeL) is a site-2 protease that belongs to the conserved family of intramembrane proteases found in Escherichia coli. It functions as a "regulated intramembrane proteolysis" (RIP) protease that cleaves transmembrane substrates to regulate signal transduction and maintain proteostasis . RseP introduces the second cleavage into anti-σE protein RseA at a position within or close to the transmembrane segment, playing a crucial role in the σE stress-response cascade .

The biological significance of RseP extends beyond E. coli, as homologs of this protease have been identified in signal transduction pathways for lipid metabolism and endoplasmic reticulum stress responses in eukaryotes . In humans, deregulation of similar proteolytic processes is associated with diseases such as Alzheimer's disease, highlighting the medical relevance of understanding these mechanisms .

What are the structural domains of RseP and how do they contribute to its function?

RseP contains several key structural domains that contribute to its proteolytic function:

  • PDZ domains: RseP contains two tandemly arranged periplasmic PDZ domains (PDZ tandem) that serve as a size exclusion filter to sterically hinder active site entry by substrates having bulky periplasmic domains . This substrate discrimination by size exclusion has also been proposed for human S2P, which has an extracytoplasmic PDZ domain .

  • Transmembrane domains: These house the catalytic center of RseP and contain the zinc-binding motif characteristic of metalloproteases .

  • MRE β-loop: Located within the membrane region, the MRE β-loop interacts with the substrate near the bond that is cleaved and contributes to substrate discrimination .

  • GxG motif region: This conserved motif is located on a membrane-associated region between transmembrane segments 1 and 2 (TMS1 and TMS2) and is involved in substrate interaction .

These structural elements work together to ensure proper substrate recognition, binding, and cleavage within the membrane environment.

How does RseP recognize and bind its substrates?

RseP recognizes its substrates through specific structural interactions. While it primarily cleaves RseA in the σE stress-response pathway, research has shown that RseP can also cleave transmembrane sequences of other membrane proteins unrelated to RseA, provided that the transmembrane region contains residues of low helical propensity .

The substrate binding mechanism involves several steps. First, the substrate transmembrane helix is unwound by strand addition to the intramembrane β sheet of RseP . The substrate is then clamped by a conserved asparagine residue (N394) at the active center for efficient cleavage . This asparagine residue interacts with the substrate backbone, and mutation studies (particularly N394D) have shown that hydrogen bonding via the amide group of the N394 side chain is critical for cleavage activity .

Additionally, the MRE β-loop and the GxG motif region of RseP interact with the substrate, further contributing to substrate recognition and binding . This mechanism of substrate binding—unwinding and clamping—appears to be common across different families of intramembrane proteases that cleave transmembrane segments .

What is the mechanism of intramembrane proteolysis by RseP?

The mechanism of intramembrane proteolysis by RseP involves several coordinated steps:

  • Conformational changes: The RseP domains surrounding the active center undergo conformational changes to expose the substrate-binding site, suggesting that RseP has a gating mechanism to regulate substrate entry . A conserved electrostatic linkage between the transmembrane and peripheral membrane-associated domains mediates these conformational changes .

  • Substrate unwinding: The substrate transmembrane helix is unwound by strand addition to the intramembrane β sheet of RseP, allowing it to access the active site .

  • Substrate clamping: A conserved asparagine residue (N394) clamps the substrate at the active center. This residue interacts with the substrate backbone on the opposite side of the MRE β-sheet .

  • Proteolytic cleavage: RseP cleaves the substrate at a specific position within the transmembrane region. In the case of RseA, cleavage occurs between Ala108 and Cys109, well inside the predicted transmembrane sequence .

  • Product release: After cleavage, the N-terminal fragment is released while being shielded from the hydrophobic milieu of the lipid bilayer by the surrounding transmembrane helices of RseP .

This mechanism allows RseP to perform proteolysis within the hydrophobic environment of the membrane, a process that would normally be energetically unfavorable.

How does RseP contribute to cell stress response pathways?

RseP plays a critical role in the σE stress-response pathway in E. coli. Under stress conditions that affect the cell envelope, such as accumulation of misfolded outer membrane proteins, a series of proteolytic events activates the σE response:

  • Initial cleavage: The periplasmic domain of RseA (the anti-σE factor) is first cleaved by the protease DegS.

  • RseP-mediated cleavage: RseP then cleaves RseA within its transmembrane domain at a position between Ala108 and Cys109 .

  • Release of σE: This intramembrane proteolysis leads to the release of σE from RseA's inhibitory effect.

  • Transcriptional activation: The freed σE associates with RNA polymerase core enzyme to direct transcription of genes involved in envelope stress response.

This regulated intramembrane proteolysis (RIP) cascade ensures that the stress response is activated only when needed, as RseP's access to RseA is regulated by the initial DegS cleavage . The importance of RseP extends beyond E. coli, as homologs have been identified in various bacterial species and have been shown to play important roles in virulence in several animal and human pathogens .

What experimental approaches can be used to study RseP substrate specificity in vitro?

Several sophisticated experimental approaches have been developed to study RseP substrate specificity in vitro:

  • Purified component systems: Researchers have established in vitro reaction systems using purified components, including purified RseP and substrate proteins, to demonstrate that RseP catalyzes the same specificity proteolysis observed in vivo . This approach allows for controlled conditions to examine various aspects of the enzyme-substrate interaction.

  • Model substrate design: Chimeric proteins, such as MBP-RseA fusions, have proven valuable for in vitro characterization of RseP enzyme activity . The MBP (maltose-binding protein) moiety stabilizes the N-terminal cleavage product, enabling detailed studies of endoproteolysis by RseP .

  • Cysteine-scanning mutagenesis: This approach involves creating a series of cysteine substitution mutants along the predicted cleavage region of the substrate and analyzing the cleavage products using techniques such as malPEG modification . By comparing which cysteine residues are present in the cleavage products, researchers can precisely identify the cleavage site.

  • Structure-based chemical modification: Chemical modification experiments targeting specific residues can provide insights into substrate binding and catalytic mechanisms .

  • Cross-linking experiments: These can be used to identify residues that come into proximity during substrate binding and catalysis, providing information about protein-protein interactions during the proteolytic process .

These methodologies, often used in combination, have been instrumental in elucidating the mechanism of RseP-mediated intramembrane proteolysis.

How can I express and purify recombinant RseP while maintaining its enzymatic activity?

Expressing and purifying active recombinant RseP requires careful consideration of its membrane protein nature. Based on published protocols, the following approach can be recommended:

  • Expression system selection:

    • The pSIP expression system has been successfully used to express RseP orthologs in Lactobacillus plantarum .

    • E. coli expression systems may also be used, especially when working with E. coli RseP variants.

  • Construction of expression vectors:

    • Digest the expression vector (e.g., pLp1261_InvS, a pSIP derivative) with appropriate restriction enzymes (NdeI and Acc65I or XmaI) .

    • Amplify the rseP gene using high-fidelity DNA polymerase with primers containing complementary ends to the linearized vector .

    • Use In-Fusion cloning or a similar technique to insert the amplified gene into the expression vector .

  • Protein purification:

    • For membrane proteins like RseP, detergent solubilization is typically required to extract the protein from membranes while maintaining its native structure.

    • Affinity tags such as His6 can facilitate purification, as mentioned in the use of His6-MBP-RseA140 constructs in previous studies .

    • Consider using mild detergents that preserve enzymatic activity.

  • Activity preservation:

    • Conduct in vitro activity assays in detergent solution, as has been reported for successful RseP activity measurements .

    • Include appropriate metal cofactors (zinc for this metalloprotease) in purification and storage buffers.

    • Optimize buffer conditions (pH, salt concentration) to maintain stability and activity.

  • Storage considerations:

    • Store purified protein at appropriate temperature (typically -80°C) in small aliquots to avoid freeze-thaw cycles.

    • Include glycerol or other cryoprotectants in storage buffers.

These methodological considerations can help ensure the successful expression and purification of enzymatically active recombinant RseP for in vitro studies.

What structural changes occur in RseP during substrate binding and cleavage?

Crystal structures of inhibitor-bound forms of bacterial site-2 proteases, including E. coli RseP, have provided valuable insights into the structural changes that occur during substrate binding and cleavage :

  • Conformational gating mechanism: The RseP domains surrounding the active center undergo significant conformational changes to expose the substrate-binding site . This suggests that RseP has a gating mechanism to regulate substrate entry, ensuring controlled access to the active site.

  • Electrostatic linkage: A conserved electrostatic linkage between the transmembrane and peripheral membrane-associated domains mediates these conformational changes . This molecular mechanism coordinates the movement of different domains during substrate accommodation.

  • Domain rearrangement: Structural differences between E. coli RseP and its orthologs have prompted researchers to examine domain rearrangement in E. coli RseP during substrate accommodation and cleavage . These studies indicate that the relative positions of domains change during the catalytic cycle.

  • Substrate unwinding: Upon binding, the substrate transmembrane helix is unwound by strand addition to the intramembrane β sheet of RseP . This structural change in the substrate is crucial for positioning the cleavage site in the active center.

  • Active site interactions: During substrate binding, a conserved asparagine residue (N394) at the active center clamps the substrate for efficient cleavage . This interaction is critical for proper substrate positioning.

These structural insights provide a mechanistic understanding of how RseP performs proteolysis within the membrane environment and may guide the development of specific inhibitors or engineered variants with altered activities.

How can I determine the cleavage site of RseP in novel transmembrane substrates?

Determining the cleavage site of RseP in novel transmembrane substrates requires specialized techniques that account for the hydrophobic nature of these regions. Based on successful approaches used with RseA, the following methodology can be employed:

  • Cysteine-scanning mutagenesis approach:

    • Generate a series of cysteine substitution mutants along the predicted transmembrane region of your substrate protein .

    • Express these mutants in both rseP+ and ΔrseP strains to confirm RseP-dependent cleavage .

  • malPEG modification analysis:

    • After expression, precipitate total cellular proteins and solubilize them with SDS in the presence or absence of malPEG (a cysteine-reactive reagent that causes gel mobility shifts) .

    • Analyze the gel mobility shifts of the cleavage products by Western blotting .

    • The presence or absence of cysteine residues in the cleavage products can be determined by whether they exhibit malPEG-induced mobility shifts .

  • Comparative analysis:

    • By analyzing which cysteine residues are present in the N-terminal and C-terminal cleavage products, you can narrow down the cleavage site .

    • For example, if a cysteine at position X is present in the N-terminal fragment but a cysteine at position X+1 is not, cleavage likely occurs between these positions .

  • In vitro confirmation:

    • To confirm the cleavage site more directly, perform in vitro cleavage reactions using purified RseP and substrate .

    • Apply the same malPEG modification analysis to these in vitro-generated fragments .

  • Mass spectrometry analysis:

    • For more precise determination, mass spectrometry of the cleavage products can provide exact masses that correspond to specific cleavage sites.

Using this systematic approach, researchers identified that RseP cleaves RseA between Ala108 and Cys109, well inside the predicted transmembrane sequence .

What are the key residues involved in RseP catalytic activity, and how can they be mutated to study function?

Several key residues critical for RseP catalytic activity have been identified through structural and mutational studies:

  • Catalytic residues:

    • As a zinc metalloprotease, RseP contains a zinc-binding motif that is essential for catalysis .

    • N394: This conserved asparagine residue clamps the substrate at the active center and is critical for efficient cleavage . Mutation to aspartate (N394D) significantly reduces proteolytic activity while maintaining similar steric properties, indicating that hydrogen bonding via the amide group of the N394 side chain is crucial for catalysis .

  • Substrate-binding residues:

    • Residues in the MRE β-loop contribute to substrate discrimination and binding .

    • The GxG motif region is involved in substrate interaction .

To study these residues through mutation, the following methodology can be employed:

  • Site-directed mutagenesis:

    • Use splicing by overlap extension PCR to create specific mutations .

    • Amplify two fragments of the rseP sequence using primer pairs that include mutagenic primers .

    • Fuse the overlapping fragments in a second PCR reaction .

    • Clone the mutated gene into an expression vector and transform into the desired host organism .

  • Functional analysis approaches:

    • In vivo cleavage assays to assess the effect of mutations on proteolytic activity .

    • Inhibitor resistance tests, such as measuring batimastat resistance of different mutants .

    • Structure-based chemical modification experiments to examine conformational changes in mutants .

    • Cross-linking studies to investigate altered substrate interactions in mutant proteins .

  • Isosteric mutations:

    • Create mutations that maintain similar steric properties but alter chemical characteristics (e.g., N394D) .

    • These can help distinguish between the importance of physical space occupation versus specific chemical interactions.

These approaches provide a comprehensive toolkit for dissecting the functional roles of key residues in RseP activity and substrate specificity.

How does the PDZ domain influence substrate selection in RseP?

The PDZ domains of RseP play crucial roles in substrate selection and regulation through several mechanisms:

Experimental approaches to study PDZ domain function include deletion analysis, domain swapping experiments, and chimeric protein construction . These studies have highlighted the importance of PDZ domains in regulating substrate access to the proteolytic site and maintaining the specificity of intramembrane proteolysis.

What methods can be used to visualize conformational changes in RseP during proteolysis?

Visualizing conformational changes in membrane proteins like RseP during proteolysis presents technical challenges but can be approached using several advanced methods:

  • X-ray crystallography:

    • Crystal structures of inhibitor-bound forms of bacterial site-2 proteases including E. coli RseP have provided valuable static snapshots of the protein in different states .

    • By comparing structures with different bound ligands or inhibitors, researchers can infer conformational changes that occur during the catalytic cycle.

  • Structure-based chemical modification:

    • Chemical probes that react with specific amino acid side chains can be used to track the accessibility of residues during different stages of the catalytic process .

    • Changes in modification patterns can reveal conformational changes that expose or hide particular regions of the protein.

  • Cross-linking experiments:

    • Chemical cross-linking can capture transient interactions between domains or between the enzyme and substrate .

    • By identifying residues that come into proximity during different stages of catalysis, researchers can map conformational changes.

  • Molecular dynamics simulations:

    • Computational approaches can model the dynamic behavior of RseP in a membrane environment.

    • These simulations can predict conformational changes that might occur during substrate binding and catalysis.

  • Molecular modeling using AlphaFold:

    • AlphaFold-Multimer has been used to predict protein-protein interactions, such as the EntK1:RseP complex .

    • While such predictions require experimental validation, they can provide valuable hypotheses about conformational changes during binding events.

Through these complementary approaches, researchers have determined that RseP domains surrounding the active center undergo conformational changes to expose the substrate-binding site, suggesting a gating mechanism to regulate substrate entry .

How can bacteriocins that target RseP be used as research tools?

Bacteriocins that target RseP, such as the LsbB family bacteriocin EntK1, offer valuable research tools for studying this important protease:

  • Probing structure-function relationships:

    • Mutational studies of RseP combined with bacteriocin sensitivity assays can identify domains and residues important for bacteriocin binding .

    • This approach has revealed that the PDZ domain and regions near Asn359 are primarily involved in EntK1 binding to RseP .

  • Developing inhibitors and antimicrobials:

    • The LsbB family of bacteriocins is attractive for antimicrobial development because they are short, synthesized without an N-terminal leader sequence, and contain no posttranslational modification, enabling low-cost synthetic production .

    • These bacteriocins can act on vancomycin-resistant strains, highlighting their potential clinical relevance .

  • Understanding species specificity:

    • By testing bacteriocin sensitivity across different bacterial species expressing various RseP orthologs, researchers can gain insights into structural differences between RseP variants .

    • This approach has been used to create RseP hybrids to map domains responsible for bacteriocin interaction .

  • Engineering improved research tools:

    • Previous studies have shown that bacteriocins of the LsbB family can be engineered to improve both potency and alter the activity spectrum .

    • These engineered variants can provide more specific or broader tools for RseP research.

  • Therapeutic target validation:

    • RseP homologs have important roles in virulence in several animal and human pathogens, highlighting RseP as an attractive antimicrobial target .

    • Bacteriocins that target RseP can help validate this potential and guide drug development efforts.

The interaction between EntK1 and RseP provides valuable molecular insights that complement structural and biochemical studies of this important intramembrane protease.

What approaches are effective for designing inhibitors of RseP activity?

Designing effective inhibitors of RseP activity requires a multifaceted approach that leverages structural and mechanistic insights:

  • Structure-based design:

    • Crystal structures of inhibitor-bound forms of bacterial site-2 proteases, including E. coli RseP, provide templates for rational inhibitor design .

    • These structures reveal the binding mode of inhibitors like batimastat, which can inform the development of more specific and potent compounds.

  • Targeting the active site:

    • The conserved asparagine residue (N394) at the active center is critical for efficient cleavage .

    • Designing compounds that interact with this residue could disrupt the substrate clamping mechanism essential for catalysis.

  • Exploiting the substrate unwinding mechanism:

    • RseP unwinds substrate transmembrane helices by strand addition to its intramembrane β sheet .

    • Peptide-based inhibitors that mimic this interaction but resist cleavage could effectively block the active site.

  • Disrupting conformational changes:

    • The gating mechanism that regulates substrate entry involves conformational changes mediated by electrostatic linkages between domains .

    • Compounds that stabilize the "closed" conformation could prevent substrate access to the active site.

  • Bacteriocin-inspired design:

    • Natural inhibitors like the bacteriocin EntK1 provide templates for designing peptide-based inhibitors .

    • Structure-activity relationship studies of these bacteriocins can guide the development of simplified mimetics with improved properties.

  • Allosteric inhibition:

    • Targeting regions away from the active site, such as the PDZ domains or domain interfaces, could allosterically inhibit RseP activity.

    • This approach might offer greater selectivity between different S2P family members.

The development of RseP inhibitors not only provides research tools for studying protease function but also has potential therapeutic applications, as RseP homologs have important roles in virulence in several pathogens .

How can I create chimeric RseP proteins to study domain-specific functions?

Creating chimeric RseP proteins is a powerful approach to study domain-specific functions and has been successfully applied in previous research. The following methodology provides a comprehensive guide:

  • Design strategy:

    • Identify the specific domains or regions you wish to exchange between different RseP orthologs .

    • Carefully define domain boundaries based on structural predictions and sequence alignments.

    • Consider using RseP orthologs from both EntK1-sensitive and EntK1-insensitive species to create informative chimeras .

  • Construction using splicing by overlap extension PCR:

    • Amplify the desired fragments of different rseP sequences in separate PCR reactions .

    • Design primer pairs consisting of inner and outer primers, where inner primers generate overlapping complementary ends .

    • Fuse the overlapping fragments in a second PCR reaction using the outer primers .

    • Purify the fused amplicons containing the chimeric rseP gene .

  • Cloning into expression vectors:

    • Digest an appropriate expression vector (e.g., pSIP derivative) with suitable restriction enzymes .

    • Use In-Fusion cloning or a similar technique to insert the chimeric gene into the linearized vector .

    • Transform into E. coli for plasmid propagation and verification .

    • Transfer the verified plasmids into the final expression host (e.g., L. plantarum) .

  • Functional characterization:

    • Assess the activity of chimeric proteins using appropriate assays for RseP function.

    • For bacteriocin studies, measure EntK1 sensitivity using MIC50 determinations .

    • Evaluate substrate binding using fluorescence-based binding assays with FITC-labeled ligands .

  • Structural prediction tools:

    • Use protein topology prediction tools like CCTOP and domain identification tools like Pfam to verify the expected architecture of your chimeric proteins .

    • Consider using AlphaFold or similar structural prediction tools to model the chimeric proteins and assess potential structural disruptions.

This approach has been successfully used to identify regions of RseP involved in bacteriocin binding and activity, demonstrating its utility for dissecting domain-specific functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.