Recombinant Proteases secretion ATP-binding protein PrtD (prtD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for accurate delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
prtD; Proteases secretion ATP-binding protein PrtD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-575
Protein Length
full length protein
Species
Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi)
Target Names
prtD
Target Protein Sequence
MNASSERDRSLFGVLRQFRRSFWSVGIFSAVINVLMLAPSVYMLQVYDRVLASGNGITLL MLTLLMAGLCAFMGALEWVRSLLVVRLGTRIDLALNQDVFNAAFARNLEAGDGRAGLALT DLTLLRQFITGNALFAFFDVPWFPLFLLVLFLLHPWLGMLALGGTVVPGGVGLAEPASDQ STAGGSNQQSQQATHLADAQLRNADVIEAMGMLGNLRRRWLARHYRFISLQNLASERAAA VGGASKYSRIALQSLMLGLGALLAIDGKITPGMMIAGSILVGRVLSPIDQLIGVWKQWSS ARIAWQRLTRLIAAYPPRPAAMALPAPEGHLSVEQVSLRTAQGNTRLQNIHFSLQAGETL VILGASGSGKSSLARLLVGAQSPTQGKVRLDGADLNQVDKNTFGPTIGYLPQDVQLFKGS LAENIARFGDADPEKVVAAAKLAGVHELILSLPNGYDTELGDGGGGLSGGQRQRIGLARA MYGDPCLLILDEPNASLDSEGDQALMQAIVALQKRGATVVLITHRPALTTLAQKILILHE GQQQRMGLARDVLTELQQRSAANQARMNPTAAMPQ
Uniprot No.

Target Background

Function
This protein plays a crucial role in the secretion of proteases A, B, C, and G.
Protein Families
ABC transporter superfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is PrtD and what is its role in bacterial protein secretion?

PrtD functions as the ATP-binding cassette component in a specialized secretion apparatus composed of two inner membrane proteins (PrtD and PrtE) and one outer membrane protein (PrtF). This tripartite system secretes metalloproteases independently of the general export pathway encoded by the sec genes. The secretion occurs via a C-terminal secretion signal specifically recognized by this secretion apparatus.

Methodologically, researchers can identify and characterize PrtD through:

  • Sequence analysis revealing conserved Walker A and B motifs characteristic of ABC transporters

  • Membrane protein isolation techniques followed by Western blotting with anti-PrtD antibodies

  • Functional complementation experiments in PrtD-deficient strains

  • ATP-binding assays using 8-azido-ATP labeling, which specifically marks PrtD in membrane vesicles

How does PrtD's ATP-binding activity contribute to protease secretion?

PrtD exhibits P-type ATPase activity that provides the energy required for protein translocation across bacterial membranes. Experimental data shows this activity is specifically inhibited by the cognate C-terminal secretion signal of PrtG and PrtB metalloproteases (half inhibition at 0.1 μM) but not by C-terminal signals from proteins not secreted by the Prt translocator .

To investigate this mechanism, researchers should:

  • Purify PrtD using detergent solubilization of membranes followed by chromatography

  • Measure ATPase activity using colorimetric phosphate detection methods

  • Test inhibition with synthetic peptides corresponding to C-terminal secretion signals

  • Create point mutations in the ATP binding site to correlate ATP hydrolysis with secretion efficiency

ATP Binding Site MutationATPase ActivitySecretion EfficiencyReference
Wild-type PrtD100%100%
K370R (Walker A box)Significantly reducedLower secretion level
Other Walker A mutationsVariable (study-dependent)Correlated with ATPase activity--

What methods are available for isolating and characterizing functional PrtD?

To obtain functional PrtD protein for biochemical studies, researchers should follow these methodological steps:

  • Clone the prtD gene into an expression vector with an inducible promoter

  • Express in a suitable host (PrtD has been successfully overproduced in E. coli)

  • Prepare membrane fractions through differential centrifugation

  • Solubilize membrane proteins using mild detergents (e.g., DDM, CHAPS)

  • Purify using affinity chromatography if tagged protein is used

  • Verify functionality through ATPase activity assays and 8-azido-ATP binding

Common challenges include protein misfolding, inclusion body formation, and loss of activity during purification. Optimization of expression conditions (temperature, induction time) and detergent selection are critical factors for success.

How does the interaction between PrtD, PrtE, and PrtF create a functional secretion apparatus?

The PrtD-PrtE-PrtF complex forms a continuous channel spanning both inner and outer membranes. Research shows these interactions are highly specific, as demonstrated by hybrid exporter studies. The PrtD-PrtE interaction appears particularly critical, as PrtD cannot functionally associate with other membrane fusion proteins like LipC from S. marcescens .

Experimental approaches to study these interactions include:

  • Bacterial two-hybrid assays to detect protein-protein interactions in vivo

  • Co-immunoprecipitation experiments with tagged components

  • Chemical cross-linking followed by mass spectrometry analysis

  • Creation of hybrid exporters to test component compatibility

Hybrid Exporter CombinationSecretion of LipASecretion of PrtCFunctional StatusReference
LipB-LipC-PrtFYesYesFunctional
PrtD-PrtE-LipDNoNoNon-functional
PrtD-LipC-LipDNoNoNon-functional
LipB-PrtE-PrtFNoNoNon-functional

These results provide genetic evidence for specific "cross-talk" between the ABC protein and membrane fusion protein, establishing a foundation for studying interaction domains in these components .

What structural features of the Walker A box in PrtD are critical for function?

The Walker A box contains a conserved lysine (K370 in PrtD) that is essential for ATP binding and hydrolysis. Mutation of this residue to arginine results in significantly reduced ATPase activity, which directly correlates with decreased secretion of metalloproteases in vivo .

To investigate structure-function relationships:

  • Generate a series of point mutations in the Walker A motif (GxxGxGKS/T)

  • Express and purify mutant proteins

  • Assay ATP binding using 8-azido-ATP photolabeling

  • Measure ATPase activity under standardized conditions

  • Test secretion efficiency in complementation assays

When K370 in the Walker A box is mutated to arginine, the resulting protein displays lower ATPase activity, which correlates with reduced secretion of metalloproteases by strains expressing this mutated protein . This confirms the direct relationship between ATP hydrolysis and secretion function.

How do C-terminal secretion signals specifically interact with the PrtD-PrtE-PrtF system?

The C-terminal secretion signals of metalloproteases specifically inhibit PrtD ATPase activity, providing a regulatory mechanism for the secretion process. The inhibition is highly specific, as signals from proteins not secreted by the Prt translocator do not have this effect .

Methodological approaches to study this interaction:

  • Synthesize peptides corresponding to various C-terminal secretion signals

  • Perform competition assays with different concentrations of peptides

  • Use surface plasmon resonance to measure binding kinetics

  • Create chimeric signals to map essential recognition elements

  • Employ site-directed mutagenesis to identify key residues in PrtD involved in signal recognition

C-terminal Signal SourceInhibition of PrtD ATPaseHalf Inhibition ConcentrationReference
PrtG and PrtB metalloproteasesAlmost complete0.1 μM
Proteins not secreted by Prt translocatorNo significant inhibitionN/A

How does the PrtD system compare with other bacterial ABC exporters?

Multiple bacterial secretion systems utilize ABC transporters, but with distinct specificities and components. Comparative analysis reveals:

FeaturePrtD-PrtE-PrtF (E. chrysanthemi)HasD-HasE-HasF (S. marcescens)LipB-LipC-LipD (S. marcescens)SecB-dependent (Gram-positive)
Secreted proteinsMetalloproteasesHasALipA, PrtAVarious proteins
Signal locationC-terminalC-terminalC-terminalN-terminal
Energy sourceATP hydrolysisATP hydrolysisATP hydrolysisATP + SecB pathway
LPS contaminationYes (Gram-negative)Yes (Gram-negative)Yes (Gram-negative)No (LPS-free)
Expression yieldVariableVariableVariableUp to 900 mg/L reported

Experimental studies with hybrid exporters reveal that while some components can function together (LipB-LipC-PrtF), others exhibit strict specificity (PrtD cannot work with LipC) . This demonstrates the evolutionary specialization of these systems and provides opportunities for engineering new secretion pathways.

What methodologies can optimize the PrtD system for recombinant protease expression?

Optimization of the PrtD system for recombinant protein expression requires systematic engineering:

  • Signal sequence optimization:

    • Test various C-terminal sequences derived from PrtG/PrtB

    • Optimize length and composition for maximal recognition

    • Create a library of signal variants for screening

  • Expression vector engineering:

    • Balance expression levels of PrtD, PrtE, and PrtF

    • Use compatible inducible promoters (similar to the G6P-inducible system in Gram-positive bacteria)

    • Incorporate affinity tags for simplified purification

  • Host strain modification:

    • Delete competing secretion pathways

    • Reduce protease activity to prevent degradation

    • Engineer chaperone co-expression for improved folding

  • Culture optimization:

    • Determine optimal induction timing and strength

    • Develop fed-batch protocols to maximize cell density

    • Optimize media composition for protein secretion

Recent developments with Gram-positive secretion systems have achieved yields up to 900 mg/L of recombinant proteins using similar optimization strategies . While the PrtD system operates in Gram-negative bacteria (with associated LPS contamination concerns), these methodologies can be adapted to improve its performance.

How can researchers effectively create and study PrtD mutations?

For systematic analysis of PrtD structure-function relationships:

  • Site-directed mutagenesis protocol:

    • Design primers containing desired mutations (particularly in Walker A/B motifs)

    • Perform PCR-based mutagenesis using high-fidelity polymerase

    • Transform into cloning strain and verify by sequencing

    • Transfer to expression strain for functional analysis

  • Functional characterization:

    • Verify expression by Western blotting

    • Prepare membrane fractions containing mutant PrtD

    • Assay ATP binding using 8-azido-ATP labeling

    • Measure ATPase activity with colorimetric phosphate detection

    • Test complementation in secretion assays

  • Common troubleshooting approaches:

    • If protein expression is low, optimize codon usage or try different hosts

    • For unstable proteins, reduce expression temperature or add stabilizing agents

    • When facing solubility issues, screen different detergents for membrane extraction

What analytical techniques are most effective for studying the PrtD-PrtE-PrtF secretion complex?

Multiple complementary techniques provide insights into this multiprotein complex:

  • Structural analysis:

    • Cryo-electron microscopy of the assembled complex

    • X-ray crystallography of individual components

    • NMR spectroscopy for dynamic studies of smaller domains

    • Homology modeling based on related ABC transporters

  • Interaction mapping:

    • Chemical cross-linking coupled with mass spectrometry

    • Hydrogen-deuterium exchange mass spectrometry

    • FRET-based assays to monitor conformational changes

    • Surface plasmon resonance for binding kinetics

  • Functional reconstitution:

    • Proteoliposome reconstitution of purified components

    • In vitro secretion assays with fluorescent substrates

    • Single-molecule studies to observe transport events

Research on related ABC exporters suggests these complexes undergo substantial conformational changes during the transport cycle, which can be captured through a combination of these techniques.

How can researchers differentiate between specific and non-specific inhibition of PrtD ATPase activity?

When studying inhibition of PrtD ATPase activity by secretion signals, researchers should implement these methodological controls:

  • Dose-response curves:

    • Test a range of inhibitor concentrations (10 nM to 100 μM)

    • Calculate IC50 values for different peptides

    • Compare with known inhibitors (PrtG/PrtB signals show half inhibition at 0.1 μM)

  • Specificity controls:

    • Test scrambled peptides with identical amino acid composition

    • Include C-terminal signals from proteins not secreted by the Prt system

    • Use unrelated peptides of similar length and charge

  • Competitive binding assays:

    • Pre-incubate with 8-azido-ATP before adding inhibitory peptides

    • Test whether inhibition is competitive or non-competitive with ATP

    • Determine binding constants through Scatchard analysis

  • Functional correlation:

    • Correlate inhibition constants with secretion efficiency in vivo

    • Test whether peptides that inhibit ATPase activity also block secretion

    • Create chimeric peptides to map the minimal inhibitory motif

What are the most promising approaches for engineering the PrtD system for biotechnological applications?

Future research should focus on:

  • Protein engineering strategies:

    • Directed evolution of PrtD for enhanced activity and stability

    • Creation of chimeric transporters with beneficial properties from multiple systems

    • Computational design of optimized PrtD variants

  • Substrate engineering:

    • Development of universal C-terminal tags for efficient secretion

    • Creation of linker libraries for optimal protease presentation

    • Engineering of metalloproteases for enhanced stability during secretion

  • System optimization:

    • Streamlining the genetic components for minimal expression burden

    • Engineering co-expression systems with optimized stoichiometry

    • Development of high-throughput screening methods for secretion efficiency

  • Comparative systems analysis:

    • Systematic comparison with the newly developed Gram-positive secretion systems that produce LPS-free recombinant proteins

    • Evaluation of hybrid systems combining elements from different secretion pathways

    • Quantitative assessment of secretion efficiency and energy requirements

While the Gram-positive SecB-dependent system recently achieved high yields (900 mg/L) of LPS-free recombinant proteins , the PrtD system offers unique advantages for certain applications, particularly for proteins requiring C-terminal secretion signals.

What techniques can advance our understanding of the energetics of PrtD-mediated secretion?

Methodological approaches to study energetics include:

  • Real-time measurements:

    • Develop FRET-based sensors for ATP consumption

    • Create reporter systems to monitor secretion in real-time

    • Use microcalorimetry to measure heat production during secretion

  • Quantitative analysis:

    • Determine the ATP/protein ratio for secretion

    • Measure the kinetics of ATP hydrolysis during the transport cycle

    • Assess the contribution of proton motive force to secretion

  • Structure-based modeling:

    • Use molecular dynamics simulations to model energy transduction

    • Create mathematical models of the complete secretion process

    • Compare energy efficiency with other secretion systems

Understanding these energetic parameters will facilitate optimization of the system for biotechnological applications and provide insights into the fundamental mechanisms of ABC transporter function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.