Recombinant Protein AdrA (adrA)

Shipped with Ice Packs
In Stock

Description

Biological Role of AdrA

AdrA (EC 2.7.7.65) is a key enzyme in bacterial signal transduction. It catalyzes the conversion of two GTP molecules into c-di-GMP, a nucleotide that binds PilZ domain-containing proteins (e.g., cellulose synthase BcsA) to activate biofilm-related pathways . In Salmonella and E. coli, AdrA modulates:

  • Curli production: Fibrous protein structures critical for adhesion .

  • Cellulose biosynthesis: Extracellular matrix component in biofilms .

  • Environmental persistence: Survival under stress conditions .

Despite its role in in vitro biofilm formation, adrA-deficient mutants exhibit wild-type root colonization, suggesting compensatory pathways in in vivo environments .

Recombinant Production Systems

Recombinant AdrA is expressed in diverse hosts to optimize yield, solubility, and functional activity. Key systems include:

Host OrganismKey FeaturesApplicationsSources
E. coliHigh yield, low cost, minimal PTMsStructural studies, enzymatic assays
YeastBasic PTMs (e.g., disulfide bonds)Intermediate complexity studies
Mammalian cellsFull PTMs, human-like glycosylationFunctional studies, therapeutic development
BaculovirusHigh-fidelity folding, insect cell expressionVaccine antigen production

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dgcC; adrA; c0492; Probable diguanylate cyclase DgcC; DGC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
dgcC
Target Protein Sequence
MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPRAVGLAGMFLPIASTL VSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKTDAVLAGMWVGVMGVNV LPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGITVSFNSAPLEWWLSLPI IVIYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRRHWETMLRNEFDNCRRHNR DATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGGDEFAVIMSGT PAESAITAMLRVHEGLNTLRLPNTPQVTLRISVGVAPLNPQMSHYREWLKSADLALYKAK KAGRNRTEVAA
Uniprot No.

Target Background

Function
A probable diguanylate cyclase.
Database Links

KEGG: ecc:c0492

STRING: 199310.c0492

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of AdrA protein and why is it important for research?

AdrA (also known as dgcC in some organisms) functions as a diguanylate cyclase that synthesizes cyclic di-GMP, an important bacterial second messenger involved in biofilm formation, virulence, and motility regulation. This protein is of particular interest because it represents a key regulatory component in bacterial signaling networks, making it relevant for antimicrobial research and understanding bacterial adaptation . Experimental approaches using recombinant AdrA can provide insights into bacterial regulatory mechanisms that may contribute to the development of novel therapeutic strategies targeting biofilm formation.

What expression systems are most effective for recombinant AdrA production?

While multiple expression systems exist, Escherichia coli remains one of the most widely used hosts for recombinant protein expression due to its rapid growth at high cell density, relatively inexpensive substrate requirements, well-established genetic background, and the availability of numerous commercial cloning vectors and expression strains . For AdrA specifically, heterologous expression in E. coli has shown success when optimizing induction conditions, although yeast-based systems might also be considered for proteins requiring specific post-translational modifications. The selection of an appropriate expression system should be guided by the specific research requirements, including protein structure, functional activity needs, and downstream applications.

What are the key considerations for storage and stability of purified recombinant AdrA?

Recombinant proteins like AdrA require careful storage conditions to maintain stability and functionality. Generally, purified proteins should be stored at -80°C after receiving vials to ensure long-term stability . The addition of glycerol (typically 10%) to storage buffers helps prevent freeze-thaw damage . Stability can be maintained for at least 12 months under proper storage and handling conditions, but repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and activity loss . For certain applications requiring particularly stable preparations, additional stabilizers or lyophilization might be necessary depending on the specific properties of the AdrA variant being studied.

How should researchers optimize experimental conditions for maximum soluble AdrA expression?

Optimizing soluble AdrA expression requires a multivariate approach that systematically assesses multiple factors simultaneously. Rather than changing one variable at a time, researchers should implement factorial design experiments that evaluate the interactions between critical parameters . Key variables to optimize include:

ParameterFactors to ConsiderOptimization Range
TemperatureInduction temperature16-37°C
Medium compositionCarbon sources, nitrogen sourcesVarious formulations
Induction timingCell density at induction (OD600)0.4-1.0
Inducer concentrationIPTG or other inducer0.1-1.0 mM
Co-expressionChaperones, folding enhancersVarious combinations

This multivariant method allows estimation of statistically significant variables while accounting for interactions between them, providing more thorough analysis compared to traditional univariant approaches . Implementing a fractional factorial screening design with two levels for each variable can significantly reduce the number of experiments required while still yielding statistically robust results.

What strategies can overcome inclusion body formation during AdrA expression?

Inclusion body formation is a common challenge when expressing recombinant proteins like AdrA. Several strategic approaches can minimize this issue:

  • Reduce expression rate by lowering inducer concentration and cultivation temperature (typically 16-20°C), which allows more time for proper protein folding .

  • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist in proper protein folding during expression.

  • Use fusion partners like thioredoxin, MBP (maltose-binding protein), or SUMO that enhance solubility.

  • Optimize buffer conditions by adding mild solubilizing agents (low concentrations of urea, glycerol, or specific detergents) to stabilize the protein in solution.

  • Employ statistical experimental design methodologies to systematically evaluate multiple variables simultaneously, which has proven highly effective for optimizing culture conditions with minimal experiments .

When inclusion bodies cannot be avoided, researchers should develop effective refolding protocols that gradually remove denaturants while allowing the protein to adopt its native conformation.

How can multivariant analysis improve recombinant AdrA expression outcomes?

Multivariant analysis represents a powerful approach for optimizing recombinant protein expression, including AdrA. This method evaluates the effects of multiple variables simultaneously, enabling researchers to:

Implementation involves designing experiments using fractional factorial approaches where multiple variables (e.g., medium components, induction conditions) are modified simultaneously according to a statistically sound design. This strategy has successfully optimized many bioprocesses but remains underutilized for heterologous protein expression . Researchers working with AdrA can apply this method to simultaneously optimize induction time, temperature, media composition, and inducer concentration, potentially achieving several-fold increases in soluble protein yield.

What purification strategies yield maximum recovery of functional AdrA protein?

Developing an effective purification strategy for AdrA requires balancing purity requirements with maintaining protein functionality. A systematic approach should include:

  • Initial capture using affinity chromatography (if a tag like Myc-DDK is incorporated ), which can achieve >80% purity in a single step.

  • Secondary purification using ion exchange or size exclusion chromatography to remove contaminating proteins and aggregates.

  • Buffer optimization to maintain protein stability throughout purification:

    • Common buffer systems include Tris-HCl with glycine (25 mM Tris-HCl, 100 mM glycine, pH 7.3)

    • Addition of stabilizers like glycerol (10%) can help maintain protein integrity

  • Careful consideration of elution conditions to minimize activity loss while maximizing yield.

For analytical applications requiring highly pure preparations, researchers should implement quality control steps including SDS-PAGE with Coomassie staining to confirm purity levels above 80% . Additionally, activity assays specific to AdrA should be performed at each purification stage to track recovery of functional protein.

What analytical methods are most effective for characterizing AdrA functionality and purity?

Comprehensive characterization of recombinant AdrA requires multiple analytical approaches:

  • Functional Assays: Enzyme activity assays measuring the conversion of GTP to cyclic di-GMP should be the primary method for confirming functional integrity. These assays can be performed using HPLC, coupled enzyme systems, or fluorescence-based detection methods.

  • Purity Assessment:

    • SDS-PAGE with Coomassie staining (>80% purity standard)

    • Western blotting for specific detection and identity confirmation

    • Bradford or BCA assays for protein concentration determination (microplate Bradford method is common)

  • Structural Integrity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate domain organization

    • Dynamic light scattering to detect aggregation

  • Homogeneity Analysis:

    • Size exclusion chromatography to evaluate oligomeric state

    • Mass spectrometry for accurate molecular weight determination and modification analysis

When developing characterization protocols, researchers should include appropriate controls and standards to ensure result reproducibility across batches and between laboratories.

How can site-directed mutagenesis be used to study structure-function relationships in AdrA?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in proteins like AdrA. This technique allows researchers to:

  • Identify catalytic residues by creating point mutations in conserved domains, similar to the approach used for studying ADAR1 mutations (e.g., K744R mutation that affects enzymatic activity) .

  • Explore protein dynamics by altering residues involved in conformational changes associated with enzymatic activity.

  • Investigate protein-protein or protein-substrate interactions by modifying interface residues.

To effectively implement this approach:

  • Design mutations based on sequence alignments with homologous proteins and structural predictions.

  • Generate mutant constructs using PCR-based mutagenesis protocols.

  • Express and purify mutant proteins using optimized protocols developed for wild-type AdrA.

  • Perform comparative enzymatic and binding assays between wild-type and mutant proteins.

  • Use structural biology techniques to validate the effects of mutations on protein conformation.

This systematic mutational analysis can reveal critical insights into the molecular mechanisms underlying AdrA function, potentially identifying targets for inhibitor development or engineering proteins with enhanced properties for biotechnological applications.

What are the key considerations when designing experiments to study AdrA interactions with other proteins?

Studying protein-protein interactions involving AdrA requires careful experimental design:

  • Selection of Appropriate Methods:

    • Pull-down assays using tagged AdrA

    • Co-immunoprecipitation for detecting interactions in cellular contexts

    • Surface plasmon resonance for quantitative binding kinetics

    • Yeast two-hybrid or mammalian two-hybrid systems for detecting interactions in vivo

  • Controls and Validation:

    • Include non-interacting protein controls to assess specificity

    • Perform reciprocal experiments (pulling down with both interaction partners)

    • Validate interactions using multiple methodologies

    • Consider the impact of tags on interaction properties

  • Experimental Conditions:

    • Optimize buffer conditions to maintain protein stability while allowing interactions

    • Consider the role of post-translational modifications in mediating interactions

    • Evaluate the effects of different mutations on binding properties

  • Data Analysis:

    • Quantify interaction strengths using appropriate binding models

    • Perform competition experiments to assess binding sites

    • Map interaction domains through truncation or mutation analysis

By systematically addressing these considerations, researchers can generate reliable data on AdrA's interaction network, providing insights into its regulatory mechanisms and biological functions.

What approaches can resolve issues with AdrA protein degradation during expression and purification?

Protein degradation represents a significant challenge in recombinant protein production. To minimize degradation of AdrA:

  • During Expression:

    • Use protease-deficient host strains (e.g., BL21(DE3) pLysS for E. coli)

    • Optimize induction conditions (shorter induction times, lower temperatures)

    • Add protease inhibitors to culture media if necessary

  • During Purification:

    • Maintain samples at 4°C throughout purification

    • Include protease inhibitor cocktails in all buffers

    • Minimize processing time between steps

    • Consider adding stabilizing agents like glycerol (10%) to buffers

  • Analytical Approaches:

    • Monitor degradation patterns using Western blot analysis

    • Identify cleavage sites by mass spectrometry

    • Test different buffer conditions to identify stabilizing formulations

  • Storage Considerations:

    • Store purified protein at -80°C in small aliquots to avoid repeated freeze-thaw cycles

    • Validate stability over time using activity assays and SDS-PAGE analysis

By implementing these strategies, researchers can significantly improve the integrity and yield of functional AdrA protein throughout the production process.

How can researchers overcome variability in AdrA expression between experiments?

Experimental variability in recombinant protein expression represents a significant challenge for reproducible research. To address this issue with AdrA expression:

  • Standardize Protocols:

    • Implement standard operating procedures for all steps

    • Use the same reagent lots where possible

    • Maintain consistent growth conditions (temperature, shaking speed, vessel geometry)

  • Apply Statistical Design of Experiments (DoE):

    • Utilize factorial design approaches to characterize and control sources of variability

    • Include center point replicates to assess experimental error

    • Build statistical models that account for variable interactions

  • Monitor Critical Parameters:

    • Track growth curves to ensure consistent cell density at induction

    • Measure protein expression at multiple time points

    • Implement quality control checkpoints throughout the process

  • Data Analysis:

    • Use appropriate statistical methods to evaluate significant differences

    • Normalize expression data to account for differences in cell density

    • Establish acceptance criteria for experimental results

By systematically addressing these aspects, researchers can substantially reduce variability between experiments, leading to more reliable and reproducible results when working with recombinant AdrA protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.