Recombinant Protein AmpE (ampE)

Shipped with Ice Packs
In Stock

Description

Mechanistic Role in β-Lactamase Regulation

AmpE operates within the AmpR-AmpC-AmpD-AmpG regulatory network to control inducible β-lactamase expression. Key functions include:

FunctionMechanismExperimental Evidence
Signal TransductionActs as a membrane-bound sensor for peptidoglycan breakdown products (e.g., anhydromuramyl peptides) .Deletion of ampE in E. coli increased basal β-lactamase levels but preserved inducibility .
Modulation of AmpD ActivityEnhances AmpD-mediated repression of AmpC β-lactamase under non-inducing conditions .Co-expression of AmpE with AmpD reduced β-lactamase activity to wild-type levels in ampD mutants .
Interaction with AmpGCollaborates with the muropeptide transporter AmpG to relay cell wall stress signals to AmpR .STRING database analysis shows strong co-occurrence (Score: 0.878) and physical interactions between AmpE and AmpG .

3.1. Genetic and Phenotypic Studies

  • Mutation Analysis:

    • Transmembrane domain mutations (e.g., R298G) in AmpE disrupted its ability to inhibit β-lactamase dephosphorylation, implicating these regions in AMP-dependent signaling .

    • Deletion of ampE in K. pneumoniae did not alter β-lactamase induction but increased basal resistance to cefoxitin .

3.2. Recombinant Expression Challenges

  • Toxicity: Overexpression in E. coli led to growth inhibition, necessitating inducible promoters (e.g., araBAD) for controlled production .

  • Solubility: Fusion tags (e.g., thioredoxin) improved solubility but required subsequent cleavage steps .

Applications and Biotechnological Relevance

  • Antibiotic Resistance Research: Used to study β-lactamase regulation and identify novel drug targets .

  • Synthetic Biology: Engineered ampE variants are explored in biosensors for detecting cell wall-targeting antibiotics .

Interaction Network (STRING Database)

Interaction PartnerFunctionAssociation Score
AmpDCytoplasmic peptidoglycan amidase0.984
AmpGMuropeptide transporter0.878
AmpCβ-lactamase enzyme0.809
yhfKPutative transporter0.755

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve ATP-binding domain dynamics .

  • Therapeutic Targeting: Small-molecule inhibitors of AmpE could restore β-lactam efficacy in resistant pathogens .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ampE; SF0108; S0110; Protein AmpE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Shigella flexneri
Target Names
ampE
Target Protein Sequence
MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLGMTIIAMGVTFLLLRA LQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSHARATMAGELTMIHGVP AGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLMGYAFLRAWQYWLARYQT PHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWFASLGDFHTSQYQVLTRLA QFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYGALV
Uniprot No.

Target Background

Function
AmpE is a putative signaling protein involved in beta-lactamase regulation. It is believed that AmpE does not directly sense beta-lactams.
Database Links

KEGG: sfl:SF0108

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional characterization of AmpE protein?

AmpE is a 32.1 kDa integral membrane protein with multiple transmembrane domains. Structurally, AmpE contains a likely ATP-binding site positioned between the second and third putative transmembrane regions. Functionally, AmpE works alongside AmpD in sensing the effects of β-lactam antibiotics on peptidoglycan biosynthesis and relaying this signal to AmpR, the transcriptional regulator of β-lactamase expression .

Unlike direct β-lactam binding proteins, AmpE cannot be covalently labeled by benzylpenicillin, supporting the hypothesis that it functions as a signal transducer rather than a direct antibiotic sensor. Research indicates that AmpE modulates the response to cell wall stress by interacting with the peptidoglycan recycling pathway .

How does AmpE integrate with the AmpC β-lactamase regulatory system?

AmpE functions within a complex regulatory network involving multiple gene products:

Gene ProductCellular LocationPrimary Function in β-lactamase Regulation
AmpEIntegral membraneSignal transduction protein, negative regulator of serine-BLAs
AmpDCytoplasmic20.5 kDa cytoplasmic amidase, moderates β-lactamase expression
AmpRCytoplasmicTranscription factor binding to AmpIR region
AmpGTransmembranePermease transporting peptide murein debris
AmpCPeriplasmicInducible β-lactamase

The system works through coordinated sensing mechanisms. In the absence of AmpD, increasing levels of AmpE decrease the basal expression of AmpC β-lactamase in an AmpR-dependent manner. Additionally, AmpD has been shown to modulate the response exerted on β-lactamase expression by AmpE .

What expression systems are most effective for recombinant AmpE production?

The Escherichia coli expression system is most commonly utilized for recombinant AmpE production due to several advantages:

  • Well-characterized genetic information

  • Rapid growth of expression host

  • Multiple cloning vector options

  • Simple culture requirements

  • Cost-effectiveness

  • Higher product yield compared to eukaryotic systems

For membrane proteins like AmpE, several specialized approaches should be considered:

  • Use of fusion partners to increase solubility and reduce toxicity

  • Selection of appropriate promoters (T7, trc, tac, or BAD)

  • Optimization of codon usage for E. coli

  • Expression as a fusion protein with purification tags (His-tag is most common)

A comparative analysis of different expression systems for membrane proteins like AmpE shows:

Expression SystemAdvantagesDisadvantagesSuitability for AmpE
E. coli BL21(DE3)High yield, low cost, rapid growthMay form inclusion bodiesGood with fusion partners
E. coli C41/C43Better for membrane proteinsLower yield than BL21Very good
Yeast expressionBetter folding of complex proteinsLonger production cycleModerate
Mammalian cellsNative-like folding and PTMsExpensive, complex, low yieldLow necessity

How can the toxicity of recombinant AmpE to the host strain be mitigated?

Expressing membrane proteins like AmpE often presents toxicity challenges to the host strain. Several strategies can be employed to overcome this issue:

What purification strategies yield highest purity and activity for recombinant AmpE?

Purification of membrane proteins like AmpE requires specialized approaches:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Most common method when AmpE is expressed with a His-tag

    • Utilize a nickel-nitrilotriacetic acid resin–packed column under native conditions

    • Employ an imidazole gradient (0-100%) in elution buffer (20 mM NaH₂PO₄, 500 mM NaCl, 500 mM imidazole; pH 7.5)

    • Collect fractions and analyze on 15% SDS-PAGE

  • Tag removal:

    • For AmpE without methionine residues, cyanogen bromide (CNBr) cleavage can be used to separate the target protein from the tag

    • Alternative: use specific proteases like TEV or thrombin if recognition sites are engineered

  • Final purification step:

    • Reverse-phase high-performance liquid chromatography (HPLC) provides high purity

    • Size exclusion chromatography maintains native protein structure

  • Verification of purified protein:

    • Western blotting using HRP-conjugated anti-His-tag antibodies

    • Mass spectrometry for accurate molecular weight determination

How can researchers address data inconsistencies in AmpE functional assays?

When faced with contradictory data in AmpE functional studies, researchers should implement a structured approach:

  • Examine the data thoroughly to identify discrepancies and patterns that contradict initial hypotheses .

  • Evaluate experimental variables that might affect AmpE function, including:

    • Detergent selection for membrane protein solubilization

    • Lipid composition of reconstitution systems

    • Buffer conditions affecting AmpE stability and activity

    • Expression system influence on protein folding and activity

  • Consider alternative explanations based on AmpE's known properties. For example, inconsistent results might stem from:

    • Incomplete solubilization of the membrane protein

    • Partial denaturation during purification

    • Altered function due to tag interference

    • Loss of essential lipid interactions

  • Implement additional controls such as:

    • Complementation assays in ampE deletion mutants to verify functional activity

    • Site-directed mutagenesis of key residues to validate function

    • Parallel testing with multiple detection methods

How does AmpE interact with other components of the β-lactamase regulatory system?

Research into AmpE interactions reveals complex relationships with other regulatory components:

  • AmpE-AmpD interaction: AmpD modulates the response exerted on β-lactamase expression by AmpE. In the absence of AmpD, increasing levels of AmpE decrease basal expression of AmpC β-lactamase in an AmpR-dependent manner .

  • Differential effects on serine β-lactamases: Recent studies show that β-lactam resistance is decreased upon ampE expression, indicating that AmpE acts as a negative regulator of serine-BLA. This contrasts with the effect of AmpD overexpression, which increases β-lactam resistance .

  • Transmembrane signaling mechanism: Despite earlier hypotheses suggesting AmpE might function as a β-lactam-binding sensory transducer, current evidence indicates that neither AmpD nor AmpE are needed for β-lactam induction, and they cannot be covalently labeled by benzylpenicillin. Instead, AmpE likely senses the effect of β-lactam action on peptidoglycan biosynthesis and relays this signal to AmpR .

How can genetic engineering enhance recombinant AmpE stability and functionality?

Several advanced genetic engineering approaches can optimize AmpE expression:

  • Dimerization strategies: Similar to what has been demonstrated with antimicrobial peptides, dimerization of membrane proteins can enhance stability and function. Researchers can design dimeric AmpE constructs using flexible linkers such as GPDGSGPDESGPDES to connect monomeric units while maintaining their spatial configuration and activity .

  • Codon optimization: The mRNA structure can be optimized based on low ΔG (dG) and energy of the start codon to help ribosome binding and translation initiation. This approach has shown success in other membrane protein expression systems .

  • Fusion partner selection: Strategic selection of fusion partners can dramatically improve both expression and purification:

Fusion PartnerSize (kDa)Benefits for AmpE ExpressionCleavage Method
Thioredoxin12Enhances solubilityEnterokinase
SUMO11Enhances foldingSUMO protease
MBP42Increases solubilityFactor Xa
His-tag1Simplifies purificationCNBr or proteases
  • Vector design considerations: For optimal AmpE expression, researchers should select vectors with appropriate features:

    • Origin of replication affecting copy number (p15A for low copy, pMB1 for medium copy)

    • Promoter selection (T7, trc, tac, or BAD)

    • Inclusion of appropriate regulatory elements

What are common pitfalls in recombinant AmpE expression and how can they be overcome?

Researchers frequently encounter specific challenges when working with recombinant AmpE:

  • Low expression levels:

    • Solution: Optimize codon usage for the host organism

    • Use specialized strains designed for membrane protein expression

    • Test multiple fusion partners to identify optimal configuration

  • Protein misfolding and aggregation:

    • Solution: Reduce expression temperature (16-25°C)

    • Add membrane-mimetic environments during expression (detergents or lipids)

    • Express with chaperones to aid folding

  • Poor purification yield:

    • Solution: Optimize solubilization conditions with different detergents

    • Implement two-step purification protocols

    • Use mild elution conditions to maintain protein integrity

  • Inconsistent functional assays:

    • Solution: Standardize reconstitution procedures

    • Verify protein orientation in membrane systems

    • Develop robust activity assays specific to AmpE function

How can researchers evaluate whether their recombinant AmpE retains native functionality?

Confirming functional integrity of recombinant AmpE requires multiple complementary approaches:

  • Genetic complementation assays:

    • Transform recombinant ampE into ΔampE mutant strains

    • Measure restoration of wild-type β-lactamase expression patterns

    • Compare MIC (Minimum Inhibitory Concentration) values of β-lactam antibiotics

  • Membrane integration analysis:

    • Confirm proper membrane localization using cell fractionation

    • Analyze transmembrane topology using protease accessibility assays

    • Use GFP fusion proteins to visualize membrane localization

  • Functional interaction testing:

    • Measure impact on AmpC β-lactamase expression levels

    • Assess interactions with other components of the regulatory system

    • Compare effects of wild-type versus mutant AmpE variants

Researchers have demonstrated that β-lactam resistance is decreased upon ampE expression, providing a clear phenotypic readout for functional activity assessment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.