Recombinant Protein cab-1 (cab-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cab-1; C23H4.1; Protein cab-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-425
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
cab-1
Target Protein Sequence
MRYTFSDEKKATTTTTSRAKSQARLLNSASYRRAARTTLRHSYGMGMWRAVALLACLSAT HAALFTEGGAVQNGKDNKANKYVEFAHDDKINKEDLLKYYGKEVEQYKDDDSYMEYLIEY MKSHPVPAQFPNFEQEAEQEHQDELNQWLEQLMNEQELLEPANAAVKDAEQKAPLAPVHH KQVAQKPAQEPFDLDDLLRGELMLENEIAKESELKKTQEKLSEQTPSAKANVESLESAMQ TATGEPQVPQKKGQNEFVSFVEQEPQPAKQTISSQTVDKRRLATSAEYSGSAPRYSSSSL LLLAVGTVMCVGLIGTVAGGTYYYKNNRRTETPDDGEYAPYAGTGPGFRKNKGNKGDETL AYKAQLHQYQQAKQKIICGEDAPGIIESDGEDGADEENNYSVYECPGLAPTGDIEVCNPN FAAQP
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C23H4.1

STRING: 6239.C23H4.1.3

UniGene: Cel.17893

Protein Families
NPDC1/cab-1 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in a variety of neurons.

Q&A

What Are the Primary Functional Roles of CAB-1 in Cellular Systems?

CAB-1 encompasses two distinct proteins: CACNB1 (Calcium Channel Beta 1) and NPDC1. CACNB1 modulates voltage-gated calcium channels by enhancing peak calcium currents, regulating alpha-1 subunit membrane localization, and influencing G-protein-mediated signaling . For example, CACNB1 shifts voltage dependence during channel activation/inactivation, impacting cardiac and neuronal excitability . NPDC1, part of the cab-1 family, regulates neural proliferation and differentiation, with high expression in the hippocampus and frontal cortex . It interacts with transcriptional regulators to control cell cycle progression in neuronal precursors .

Methodological Insight:

  • Use co-immunoprecipitation (Co-IP) to map interactions (e.g., CACNB1 with Gα subunits) .

  • Employ RNA interference in neural stem cells to study NPDC1’s role in differentiation .

CACNB1 Production:

  • Host System: E. coli or yeast for cost-effective soluble protein yields .

  • Tags: Epitope tags (e.g., His-Tag) aid purification via immobilized metal affinity chromatography (IMAC) .

  • Critical Step: Include a 100x molar excess of control fragments (e.g., aa 506–598) to validate antibody specificity in Western blotting .

NPDC1 Production:

  • Host System: Mammalian systems (e.g., HEK293) for proper post-translational modifications .

  • Quality Control: Validate membrane localization via immunofluorescence, given its single-pass transmembrane structure .

Table 1: Recombinant CAB-1 Production Parameters

ProteinHost SystemTagKey ApplicationReference
CACNB1E. coliHis-TagCalcium channel assays
NPDC1HEK293His-TagNeural differentiation

What Assays Are Recommended to Validate Recombinant CAB-1 Activity?

For CACNB1:

  • Electrophysiology: Patch-clamp recordings in HEK293 cells co-expressing CACNB1 and α1 subunits to measure calcium current modulation .

  • G-Protein Coupling: FRET-based assays to quantify Gα interaction efficiency .

For NPDC1:

  • Neurite Outgrowth Assays: Treat primary hippocampal neurons with recombinant NPDC1 and measure dendrite complexity via Sholl analysis .

  • Transcriptional Profiling: RNA-seq to identify NPDC1-dependent genes (e.g., NeuroD1, Sox2) .

How Can Contradictory Data on CAB-1’s Role in Disease Be Resolved?

Case Study: CACNB1’s association with malignant hyperthermia (MH) varies across studies.

  • Approach: Perform meta-analysis of exome data from MH cohorts, stratifying by CACNB1 splice isoforms .

  • Experimental Validation: Use CRISPR-edited myotubes to compare wild-type and mutant CACNB1 responses to ryanodine receptor activators .

For NPDC1: Discrepancies in its tumor-suppressive vs. oncogenic roles require tissue-specific knockout models. For example, deplete NPDC1 in glioblastoma vs. neuroblastoma cell lines and profile proliferation rates .

CACNB1:

  • Cryo-EM: Resolve full-length CACNB1 in complex with α1 and α2δ subunits to identify regulatory interfaces .

  • Molecular Dynamics (MD): Simulate voltage-sensing domain movements under depolarizing conditions .

NPDC1:

  • NMR Spectroscopy: Map membrane-proximal regions interacting with lipid bilayers .

  • X-Ray Crystallography: Determine the atomic structure of the N-terminal transcriptional regulatory domain .

How Do Post-Translational Modifications Impact CAB-1 Function?

CACNB1 Phosphorylation:

  • Ser/Thr phosphorylation (e.g., by PKA) reduces calcium current density. Use phosphomimetic mutants (S→D) in electrophysiology assays to confirm .

NPDC1 Ubiquitination:

  • Ubiquitin-proteasome degradation regulates NPDC1 levels during differentiation. Treat cells with MG-132 and monitor protein half-life via cycloheximide chase .

What Are Emerging Applications of CAB-1 in Gene Therapy?

CACNB1:

  • Gene delivery of dominant-negative CACNB1 mutants to attenuate arrhythmogenic calcium currents in cardiomyocytes .

NPDC1:

  • AAV-mediated NPDC1 overexpression to enhance neurogenesis in Alzheimer’s models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.