Recombinant Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

CrcB2 homologs are associated with fluoride ion transport and bacterial stress adaptation.

  • Fluoride Transport: Acts as a putative fluoride ion transporter, enabling bacterial resistance to fluoride toxicity .

  • Structural Role: In eukaryotes, Crumbs homologs (e.g., human CRB2) regulate epithelial cell polarity via PDZ domain interactions .

Pathway Involvement:
While specific pathways for bacterial crcB2 remain undefined, its eukaryotic counterpart (CRB2) participates in:

  • Cell polarity maintenance

  • Photoreceptor morphogenesis

Research Applications

Recombinant crcB2 is utilized in:

  1. Mechanistic Studies: Investigating fluoride transport mechanisms in prokaryotes .

  2. Protein-Protein Interaction Assays: Mapping binding partners using pull-down or yeast two-hybrid systems .

  3. Antimicrobial Development: Targeting fluoride export pathways for novel antibiotics .

Stability and Handling

  • Shelf Life: 6–12 months at -80°C .

  • Freeze-Thaw Cycles: Avoid repeated cycles; aliquot working volumes .

  • Buffer Compatibility: Tris/PBS-based formulations with trehalose or glycerol enhancers .

Limitations and Future Directions

Current research gaps include:

  • Detailed structural resolution (e.g., cryo-EM data).

  • Elucidating crcB2’s role in bacterial virulence.

  • Comparative studies between prokaryotic and eukaryotic homologs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB2; DIP1884; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Target Names
crcB2
Target Protein Sequence
MIPALFLAAALGGMLRFLLSKIGPYVGTFIANMAACVVLAAVRDASPLVMAAVGTGFAGA LSTWSTLAKELGTLIRQRRWAMLLGYTTATILGGMVAVWCGLQI
Uniprot No.

Target Background

Function
Crucial for reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links

KEGG: cdi:DIP1884

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for recombinant membrane proteins?

The choice of expression system depends significantly on the properties of your target protein. For membrane proteins similar to cannabinoid receptors, both prokaryotic and eukaryotic systems offer distinct advantages:

The selection should be guided by:

  • Research objectives (structural studies vs functional assays)

  • Required protein yields

  • Post-translational modification requirements

  • Available resources and expertise

How can experimental design improve recombinant protein solubility?

Improving protein solubility requires systematic optimization of multiple variables simultaneously. Statistical experimental design methodologies offer advantages over traditional one-variable-at-a-time approaches:

  • Multivariant analysis: Allows evaluation of multiple variables simultaneously while characterizing experimental error and comparing effects between normalized variables .

  • Key parameters to optimize:

    • Induction timing and duration

    • Expression temperature

    • Media composition

    • Inducer concentration

    • Host strain selection

For example, researchers studying pneumolysin expression determined that induction times between 4-6 hours presented similar productivity levels, while times longer than 6 hours decreased productivity . This type of systematic analysis allows for identification of optimal conditions with fewer experiments.

What purification strategies are effective for membrane proteins?

Membrane proteins require specialized purification strategies:

  • Affinity chromatography: The primary method for initial purification, typically using histidine tags as demonstrated with CB2 receptor purification .

  • Reconstitution into lipid environments: Critical for maintaining native conformation. For example, CB2 receptor has been successfully reconstituted into lipid bilayers in the form of proteoliposomes suitable for NMR spectroscopy .

  • Quality control: Verify protein folding and functionality through binding assays or activity tests specific to your protein class.

A typical workflow involves:

  • Cell lysis in detergent-containing buffers

  • Membrane fraction isolation

  • Solubilization with appropriate detergents

  • Affinity purification

  • Size exclusion chromatography

  • Reconstitution into appropriate membrane mimetics

How can statistical experimental design optimize recombinant protein expression?

Advanced experimental design methodologies significantly improve expression optimization:

  • Fractional factorial screening design: Allows evaluation of multiple variables with fewer experiments while preserving statistical orthogonality . For instance, researchers achieved high levels of soluble pneumolysin (250 mg/L) by implementing a design that evaluated eight variables related to medium composition and induction conditions .

Design ApproachAdvantagesApplication Example
Fractional factorial (2^8-4)Reduces experiments while maintaining statistical powerOptimization of soluble pneumolysin expression
Randomized complete block designControls for unit-to-unit variabilityTesting different expression conditions across multiple batches
Central point replicatesEstimates experimental errorValidating reproducibility of optimal conditions

The implementation requires:

  • Identifying relevant variables (temperature, inducer concentration, media components)

  • Establishing appropriate response measurements (protein yield, solubility, activity)

  • Statistical analysis to identify significant effects

  • Confirmation runs to validate optimal conditions

This approach not only optimizes expression but also provides statistical confidence in the reproducibility of results .

What considerations are important for stable isotope labeling of recombinant proteins for structural studies?

Stable isotope labeling is essential for NMR spectroscopy of proteins. Key considerations include:

  • Labeling strategies: For CB2 receptor, both selective tryptophan labeling with [^13C, ^15N] and uniform labeling with ^13C and ^15N have been successful .

  • Expression conditions: Labeled proteins require expression in defined media with controlled aeration, pH, and temperature. The composition of this media is critical for maintaining protein folding while incorporating isotopes .

  • Verification of incorporation: Mass spectrometry should confirm labeling efficiency.

  • Functional assessment: Labeled proteins must retain native activity, which should be verified through appropriate functional assays.

A successful labeling protocol for membrane proteins like CB2 includes:

  • Adaptation of expression strain to minimal media

  • Optimization of growth and induction conditions in isotope-enriched media

  • Careful purification to maintain protein integrity

  • Reconstitution into appropriate membrane mimetics for structural studies

How to design constructs that improve expression and stability of challenging recombinant proteins?

Protein construct design can dramatically impact expression success:

The CRBN midi construct development demonstrates an effective approach:

  • The construct expresses readily from E. coli as soluble, stable protein without requiring co-expression of binding partners .

  • It maintains wild-type functionality while providing sufficient protein for biophysical and structural studies.

  • This enabled high-resolution co-crystal structures of binary and ternary complexes .

Key design principles include:

  • Bioinformatic analysis to identify domains and disordered regions

  • Secondary structure prediction to guide truncation sites

  • Evolutionary conservation analysis

  • Surface entropy reduction for crystallization

  • Fusion tags selection based on target properties

What methods are most effective for functional characterization of recombinant membrane proteins?

Functional assessment of membrane proteins requires specialized approaches:

  • Ligand binding assays: Quantify interaction with known ligands using techniques like surface plasmon resonance or isothermal titration calorimetry.

  • Activity assays: For enzymes like LOXL2, specific activity can be calculated using fluorescence-based assays with the formula:
    Specific Activity (pmol/min/μg)=Adjusted Fluorescence (RFU)×Conversion Factor (pmol/RFU)Incubation time (min)×amount of enzyme (μg)Specific~Activity~(pmol/min/μg) = \frac{Adjusted~Fluorescence~(RFU) \times Conversion~Factor~(pmol/RFU)}{Incubation~time~(min) \times amount~of~enzyme~(μg)}

  • Structural integrity assessment: Techniques like circular dichroism spectroscopy can verify proper folding.

  • Reconstitution verification: For membrane proteins like CB2, proper incorporation into lipid bilayers should be verified through techniques like freeze-fracture electron microscopy or dynamic light scattering .

How to address inclusion body formation in E. coli expression systems?

Inclusion body formation is a common challenge with membrane and complex proteins. Several strategies can mitigate this issue:

  • Temperature optimization: Lower expression temperatures (15-25°C) often improve folding by slowing protein synthesis.

  • Co-expression with chaperones: Molecular chaperones like GroEL/GroES can assist proper folding.

  • Fusion tags: Solubility-enhancing tags like MBP, GST, or SUMO can improve folding outcomes.

  • Mild solubilization: Using detergents like n-dodecyl β-D-maltoside (DDM) can recover properly folded protein from membrane fractions.

Statistical design of experiments can efficiently identify optimal combinations of these factors, as demonstrated in studies optimizing pneumolysin expression .

What strategies can overcome low expression yields in eukaryotic systems?

Low expression yields in eukaryotic systems can be addressed through:

  • Codon optimization: Adapting the coding sequence to the host's codon usage preferences.

  • Signal sequence optimization: Modifying secretion signals to improve translocation.

  • Media and feed optimization: Implementing design of experiments approach to identify optimal nutrient compositions and feeding strategies.

  • Cell line selection: Testing multiple cell lines, as expression levels can vary significantly between hosts.

  • Transfection optimization: Systematic evaluation of transfection reagents, DNA:reagent ratios, and timing.

For example, the Cereblon construct (CRBN midi) was specifically designed to express well in E. coli without requiring co-expression with DDB1, demonstrating how rational construct design can overcome expression challenges .

How to maintain protein stability during purification and storage?

Maintaining stability of recombinant proteins throughout purification and storage requires:

  • Buffer optimization: Systematic screening of buffer components, pH values, and ionic strengths.

  • Stabilizing additives: Glycerol, specific ligands, or reducing agents can significantly enhance stability.

  • Storage conditions: Optimization of temperature, protein concentration, and freeze-thaw cycles.

For membrane proteins like CB2:

  • Detergent screening is critical to identify conditions that maintain native structure

  • Reconstitution into lipid bilayers in the form of proteoliposomes has proven effective for long-term stability

  • Appropriate ligands can stabilize the native conformation

What approaches are effective for structural characterization of membrane proteins?

Structural characterization of membrane proteins requires specialized approaches:

  • NMR spectroscopy: Effective for dynamic studies and requires isotope labeling as demonstrated with CB2 receptor . Stable isotope labeling with [^13C, ^15N]tryptophan or uniform labeling enables detailed structural analysis.

  • X-ray crystallography: Requires highly pure, homogeneous, and stable protein samples. The CRBN midi construct exemplifies how rational design can enable high-resolution co-crystal structures of binary and ternary complexes .

  • Cryo-electron microscopy: Increasingly important for membrane proteins that resist crystallization.

  • Hydrogen-deuterium exchange mass spectrometry: Provides insights into protein dynamics and ligand interactions.

A comprehensive characterization typically incorporates multiple complementary techniques to overcome the limitations of individual methods.

How to implement quality control for recombinant protein preparations?

Rigorous quality control is essential for reliable research outcomes:

  • Purity assessment: SDS-PAGE under reducing and non-reducing conditions, as demonstrated with Lysyl Oxidase Homolog 2 protein analysis .

  • Identity confirmation: Mass spectrometry for molecular weight verification and peptide mapping.

  • Homogeneity analysis: Size exclusion chromatography and dynamic light scattering.

  • Functional verification: Activity assays specific to the protein class. For enzymes like LOXL2, specific activity calculations using fluorescence-based assays provide quantitative functional assessment .

  • Stability monitoring: Thermal shift assays to evaluate buffer conditions and ligand effects on protein stability.

Documentation of these quality metrics ensures experiment reproducibility and reliable interpretation of research outcomes.

How to implement randomized complete block design for protein expression optimization?

Randomized Complete Block Design (RCBD) offers advantages for protein expression optimization:

  • Design principle: Experimental units are grouped into blocks (replicates) where conditions within each block are as uniform as possible, reducing experimental noise and increasing precision .

  • Implementation:

    • Each treatment (expression condition) appears once per replicate

    • Randomization occurs within each replicate independently

    • Each treatment has equal probability of assignment to any experimental unit

Advantages of RCBDImplementation Considerations
Generally more precise than completely randomized designBlocks should contain uniform experimental units
No restriction on number of treatments or replicatesLarge variation within blocks may increase error term
Some treatments may have different replication numbersTreatments should be randomized within each block
Missing data points can be easily estimatedEntire blocks or treatments can be removed from analysis if needed

Example application: Testing four different induction temperatures for protein expression across three independent batches of cell preparation, where each batch serves as a block .

How to balance replication needs with resource constraints in recombinant protein research?

Efficient experimental design balances statistical power with resource limitations:

  • Fractional factorial designs: When investigating many variables, fractional designs maintain statistical rigor while reducing experiment numbers. A 2^8-4 design (evaluating 8 variables at 2 levels each) requires only 16 experimental runs instead of 256 .

  • Power analysis: Determine minimum sample sizes needed for statistical significance based on expected effect sizes and variability.

  • Central composite designs: Provide detailed information about response surfaces with fewer experiments than full factorial designs.

  • Sequential approach: Initial screening followed by detailed optimization of significant factors conserves resources while maximizing information gain.

This strategic approach has enabled researchers to develop optimal processes for high-level soluble expression of functional proteins with minimal experimental effort .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.