Recombinant Protein CrcB homolog 3 (crcB3)

Shipped with Ice Packs
In Stock

Description

Protein Classification and Nomenclature

CrcB homolog 3 belongs to a family of proteins associated with fluoride ion transport. The protein is also known by several synonyms including "Putative fluoride ion transporter CrcB 3" and is encoded by the crcB3 gene . In Yersinia pestis, this gene is annotated as YPO2677, y1249, or YP_2478, reflecting different genomic databases and annotation systems . The protein's classification within the broader CrcB family suggests evolutionary relationships with other bacterial fluoride transporters.

Expression Systems

Recombinant production of CrcB homolog 3 protein is typically accomplished using bacterial expression systems, with Escherichia coli being the predominant host organism . The use of E. coli provides several advantages for the production of bacterial proteins, including rapid growth, high protein yields, and well-established genetic manipulation techniques. For research applications, the full-length sequence (amino acids 1-126) of the Yersinia pestis crcB3 is commonly expressed with an N-terminal histidine tag .

Membrane Association and Topology

The amino acid sequence of crcB3 suggests a membrane-spanning topology, consistent with its proposed function in ion transport. The protein contains hydrophobic regions that likely form transmembrane domains, facilitating its integration into cellular membranes. This membrane association is critical for its putative role in fluoride transport, allowing the protein to create channels or pores through which fluoride ions can be transported across the cell membrane .

Reconstitution Protocol

Reconstitution of lyophilized crcB3 protein typically follows a standard protocol:

  1. Brief centrifugation of the vial prior to opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol (recommended final concentration of 50%) for long-term storage

  4. Aliquoting for storage at -20°C/-80°C

Working aliquots may be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended .

Relationship to Viral Protein Transport Mechanisms

While crcB3 functions in bacterial systems, parallels can be drawn with viral protein transport mechanisms. For instance, the Coxsackievirus B3 protein 3A (CVB3-3A) also functions as a membrane-associated protein that interacts with cellular membranes, particularly those of the endoplasmic reticulum (ER) and Golgi apparatus . Although these proteins derive from different organisms and serve distinct functions, they share commonalities in their membrane association and potential roles in modulating cellular transport processes.

CVB3-3A, like crcB3, contains conserved residues that are critical for its function. For example, cysteine 38 in CVB3-3A supports viral replication and presents a virulence trait, highlighting the importance of specific amino acid residues in membrane-associated proteins . Similar structure-function relationships likely exist for crcB3, where specific amino acid residues may be critical for its fluoride transport capabilities, though detailed mutagenesis studies of crcB3 are not described in the available literature.

Distinction from CREB3 Transcription Factors

It is important to note that despite the similar nomenclature, CrcB homolog 3 (crcB3) is entirely distinct from CREB3 (cAMP responsive element binding protein 3) transcription factors . While crcB3 functions as a membrane-associated transporter in bacterial systems, CREB3 transcription factors are ER-localized proteins in eukaryotic cells that function as stress transducers . CREB3 proteins undergo regulated intramembrane proteolysis and the released N-terminal domains act as transcription factors regulating gene expression . This distinction underscores the importance of careful consideration of protein nomenclature in biological research.

Current Research Applications

Recombinant crcB3 protein has potential applications in various research areas:

  1. Structural biology studies to determine the three-dimensional structure of fluoride transporters

  2. Functional assays to investigate ion transport mechanisms

  3. Antibody production for immunological detection and localization studies

  4. Protein-protein interaction studies to identify binding partners

  5. Development of inhibitors for potential antimicrobial applications

Future Research Directions

Several promising directions for future research on crcB3 include:

  1. Detailed structural analysis through crystallography or cryo-electron microscopy

  2. Comprehensive functional characterization of its fluoride transport capabilities

  3. Investigation of its potential role in bacterial virulence and pathogenesis

  4. Comparative analysis with other CrcB homologs across different bacterial species

  5. Exploration of its potential as a target for novel antimicrobial agents

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB3; SAV_1942; Putative fluoride ion transporter CrcB 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Target Names
crcB3
Target Protein Sequence
MRADESGPERESREPTHIPGAEPELGGEPTPRGEPGPGFEPGPGGEPAPSRAPFRSRLRK GVLAAVALGGVLGGSARYALGLTFPTPRGTFPVTTFAVNVSGAFLLALLLVYVLEIWPPT RYVRPFAAVGFLGSFTTFSTWMVDTDRLLGHGHYAVAAFNVFGSLFAGLAATGLGLAIGR MALARRVRLAARHGRARRYGWWVR
Uniprot No.

Target Background

Function
Essential for reducing fluoride concentration within cells, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Crumbs homolog 3 (CRB3) and where is it primarily expressed?

CRB3 is a polarity protein expressed by Sertoli and germ cells at the basal compartment in the seminiferous epithelium. It is also notably expressed at the blood-testis barrier (BTB), where it co-localizes with F-actin, tight junction (TJ) proteins occludin/ZO-1, and basal ectoplasmic specialization (ES) proteins N-cadherin/β-catenin during specific developmental stages (IV-VII) . Unlike other members of the Crumbs family, CRB3 is characterized by its relatively small size but critical role in maintaining epithelial cell polarity.

The protein's expression pattern suggests its importance in maintaining cellular junctions and structural integrity in reproductive tissues. For researchers beginning work with CRB3, immunohistochemical staining of testicular tissue sections can provide valuable insights into its spatial distribution within different cellular compartments.

What are the key binding partners of CRB3 and what does this indicate about its function?

Research has identified that the binding partners of CRB3 in the testis include the branched actin polymerization protein Arp3 and the barbed end-capping and bundling protein Eps8 . These interactions strongly suggest CRB3's role in actin organization and cytoskeletal regulation.

The association with these proteins indicates that CRB3 functions as a regulatory component in actin microfilament assembly and organization. This is particularly significant because proper actin organization is essential for maintaining the structural integrity of cell-cell junctions, especially at the blood-testis barrier.

How does CRB3 knockdown affect cellular structures and functions?

CRB3 knockdown (KD) experiments have revealed significant impacts on cellular structures and functions. When CRB3 is knocked down in Sertoli cells with an established tight junction (TJ)-permeability barrier, it disrupts the TJ-barrier through alterations in the distribution of TJ- and basal ES-proteins at the cell-cell interface .

The mechanism behind this disruption involves CRB3 KD-induced re-organization of actin microfilaments. Specifically, actin microfilaments become truncated and extensively branched, destabilizing F-actin-based adhesion protein complexes at the BTB . This reorganization fundamentally affects the structural integrity of cellular junctions.

In vivo studies using Polyplus in vivo-jetPEI as a transfection medium for CRB3 KD in the testis have demonstrated even more profound effects, including:

These findings collectively suggest that CRB3 plays a crucial role as an actin microfilament regulator, particularly in organizing actin filament bundles at the ectoplasmic specialization.

What experimental techniques are most effective for studying CRB3's role in actin organization?

To effectively study CRB3's role in actin organization, researchers should employ multiple complementary techniques:

  • RNA interference (RNAi): For knockdown studies in cell cultures or in vivo models to observe functional consequences of CRB3 depletion

  • Co-immunoprecipitation (Co-IP): To confirm and characterize interactions between CRB3 and actin-regulating proteins such as Arp3 and Eps8

  • Confocal microscopy with actin labeling: To visualize changes in actin cytoskeleton organization following CRB3 manipulation

  • Barrier function assays: To measure tight junction integrity (particularly relevant when studying BTB function)

  • Fluorescence recovery after photobleaching (FRAP): To study the dynamics of CRB3 and actin at cellular junctions

When designing experiments, it's crucial to include appropriate controls and consider the potential for compensatory mechanisms that might be activated in response to CRB3 manipulation.

What are the key variables to control in CRB3 experimental research?

When designing experiments to study CRB3, researchers should carefully control several variables to ensure valid and reproducible results:

Variable TypeExamplesControl Method
Independent VariablesCRB3 expression levels, cell/tissue type, experimental durationPrecise RNAi titration, appropriate cell selection, standardized timepoints
Dependent VariablesActin organization, junction integrity, cellular polarityQuantitative imaging metrics, permeability assays, polarity markers
Control VariablesCell passage number, culture conditions, transfection efficiencyConsistent protocols, matched controls, transfection markers
Confounding VariablesExpression of other polarity proteins, cell cycle stage, stress responsesCo-expression analysis, synchronization, stress marker monitoring

Following standardized experimental design principles is essential, including hypothesis formulation, appropriate controls, and statistical planning . For between-subjects designs, ensure random assignment of samples to treatment groups to minimize bias .

How should researchers approach CRB3 knockdown experimental design?

When designing CRB3 knockdown experiments, consider the following methodological approach:

  • Define research variables clearly: Establish CRB3 knockdown as your independent variable and specify dependent variables such as actin organization, junction integrity, or cellular transport functions

  • Formulate a specific hypothesis: For example, "CRB3 knockdown will reduce tight junction integrity by disrupting actin filament organization at cell-cell interfaces"

  • Design appropriate knockdown strategy: Consider using multiple siRNA/shRNA sequences targeting different regions of CRB3 to confirm specificity of effects

  • Include essential controls:

    • Negative control (non-targeting siRNA/shRNA)

    • Positive control (knockdown of known junction disruptor)

    • Rescue experiment (re-expression of RNAi-resistant CRB3)

  • Plan for quantitative measurements: Design data collection methods that allow for statistical analysis of results

Multiple trials should be conducted to ensure reliability of observations, as exemplified in the experimental format below:

Treatment GroupTrial 1Trial 2Trial 3Mean ValueStandard Deviation
Control siRNA[value][value][value][calculated][calculated]
CRB3 siRNA #1[value][value][value][calculated][calculated]
CRB3 siRNA #2[value][value][value][calculated][calculated]
Rescue[value][value][value][calculated][calculated]

This approach follows experimental design best practices outlined in scientific methodology guides .

What imaging techniques provide the most insight into CRB3's function in epithelial polarity?

For studying CRB3's role in epithelial polarity, several advanced imaging techniques offer complementary insights:

  • Super-resolution microscopy (STED, PALM, STORM): These techniques overcome the diffraction limit of conventional microscopy, allowing visualization of CRB3 localization at nanometer resolution. This is particularly valuable for examining CRB3's precise position relative to tight junction complexes and actin filaments.

  • Live-cell imaging with fluorescently tagged CRB3: This approach enables tracking of CRB3 dynamics during junction formation, maintenance, and remodeling. Time-lapse imaging can reveal transient interactions with actin-regulating proteins.

  • Correlative light and electron microscopy (CLEM): Combining fluorescence imaging of CRB3 with electron microscopy of the same sample provides both molecular specificity and ultrastructural context.

  • Proximity ligation assay (PLA): This technique can confirm in situ protein-protein interactions between CRB3 and its binding partners within the native cellular environment.

When implementing these techniques, researchers should consider experimental controls that account for potential artifacts introduced by protein tagging or fixation procedures.

How can researchers effectively study the impact of CRB3 mutations on protein function?

To systematically study CRB3 mutations, researchers should consider this methodological workflow:

  • Bioinformatic analysis: Begin by identifying conserved domains and potential functional motifs in CRB3. Computational prediction tools can help identify mutations likely to affect protein function.

  • Site-directed mutagenesis: Generate specific CRB3 mutations in expression constructs, focusing on:

    • PDZ-binding motif mutations (affecting scaffolding interactions)

    • Phosphorylation site mutations (affecting regulation)

    • Transmembrane domain mutations (affecting localization)

  • Expression system selection: Choose appropriate cell lines that either naturally lack CRB3 or allow for complete knockdown of endogenous CRB3 before introducing mutant constructs.

  • Functional assays: Implement multiple assays to characterize mutant phenotypes:

    • Localization analysis (does the mutant protein correctly target to cell junctions?)

    • Binding partner interactions (are key protein-protein interactions maintained?)

    • Junction integrity assessments (can the mutant rescue barrier function in CRB3-depleted cells?)

    • Actin organization analysis (how does the mutation affect actin filament structure?)

  • Quantitative analysis: Develop metrics for quantifying phenotypic differences between wild-type and mutant CRB3, such as:

    • Junction protein colocalization coefficients

    • Actin filament length and branching measurements

    • Barrier function parameters

This comprehensive approach enables researchers to establish clear structure-function relationships for CRB3 domains.

What statistical approaches are most appropriate for analyzing CRB3 experimental data?

When analyzing data from CRB3 experiments, the statistical approach should be tailored to the experimental design and data type:

  • For knockdown efficiency comparisons: Paired t-tests or ANOVA with post-hoc tests (e.g., Tukey's HSD) to compare expression levels across control and knockdown conditions

  • For localization studies:

    • Pearson's or Mander's correlation coefficients for colocalization analysis

    • Spatial statistics for pattern distribution analysis

  • For functional assays:

    • Repeated measures ANOVA for time-course experiments

    • Non-parametric tests (e.g., Mann-Whitney U) for data that doesn't meet normality assumptions

  • For multiple variable experiments:

    • Multiple regression analysis to assess relationships between variables

    • Principal component analysis (PCA) to identify patterns in complex datasets

Statistical power calculations should be performed prior to experimentation to determine appropriate sample sizes, particularly when working with animal models where ethical considerations mandate minimizing subject numbers while maintaining scientific validity .

How should researchers interpret seemingly contradictory results regarding CRB3 function?

When faced with apparently contradictory results regarding CRB3 function, researchers should:

  • Examine methodological differences: Different experimental approaches (in vitro vs. in vivo, knockdown vs. knockout, acute vs. chronic manipulation) can produce different outcomes. Create a systematic comparison table of methodologies across studies.

  • Consider context-dependency: CRB3 function may vary depending on:

    • Cell or tissue type

    • Developmental stage

    • Presence of stress or pathological conditions

    • Compensatory mechanisms activated in different models

  • Evaluate protein interaction networks: CRB3 functions within complex protein networks; differences in expression of interaction partners across experimental systems can alter outcomes.

  • Design reconciliation experiments: Develop experiments specifically designed to test hypotheses that could explain contradictions, such as:

    • Conducting time-course studies to identify transient vs. stable effects

    • Simultaneously manipulating CRB3 and potential compensatory proteins

    • Using rescue experiments with domain-specific mutants to pinpoint functional regions

  • Consider quantitative aspects: Contradictions may reflect threshold effects rather than binary outcomes. Dose-response experiments can help clarify such relationships.

By systematically analyzing contradictions, researchers can often uncover deeper insights into the nuanced roles of CRB3 in different biological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.