Recombinant Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Biological Functions

CrcB homologs are implicated in fluoride ion (F⁻) homeostasis and resistance:

  • Fluoride Efflux: Acts as a fluoride transporter, reducing intracellular F⁻ concentrations to mitigate toxicity .

  • Operon Regulation: Co-expressed with genes like uspA (universal stress protein) and eno (enolase) under fluoride-induced stress, forming a fluoride-responsive operon .

  • Stress Adaptation: Supports microbial survival in high-fluoride environments, such as dental biofilms or industrial settings .

3.1. Mechanistic Studies

  • Fluoride Resistance Pathways: Studies using Enterobacter cloacae show crcB deletion reduces fluoride tolerance by 50%, confirming its role in efflux .

  • Gene Expression Profiling: Fluoride exposure upregulates crcB expression by 8–15 fold, as demonstrated via RNA-seq and qRT-PCR .

3.2. Therapeutic Development

  • Vaccine Targets: Recombinant P. aeruginosa CrcB is used in vaccine research due to its surface exposure and role in pathogenicity .

  • Antibiotic Adjuvants: Targeting CrcB could enhance fluoride-based antimicrobial therapies by disrupting bacterial ion balance .

4.1. Fluoride Riboswitch Interaction

A fluoride-sensitive riboswitch upstream of the crcB operon regulates its transcription. Fluoride binding induces structural changes in the RNA, activating operon expression .

Future Directions

Current research gaps include elucidating CrcB’s interaction with other efflux pumps and its potential as a biomarker for fluoride resistance in clinical isolates. Advances in cryo-EM could further resolve its ion transport mechanism.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are standardly shipped with regular blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; WS1138; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) (Vibrio succinogenes)
Target Names
crcB
Target Protein Sequence
MQTLLAIFVGAGFGALLRWFLGLKLNALAPLIPLGTLGANWLGGYLIGLALAFFSTHPLL SPEWRLLIITGFLGGLTTFSTFSAEMVSLLQWGRYGALALGVALHVGGSIGMTLLGIFTF SFIQRIGG
Uniprot No.

Target Background

Function
Crucial for reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links

KEGG: wsu:WS1138

STRING: 273121.WS1138

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB homolog protein and what is its primary function?

The CrcB homolog is a membrane protein involved in fluoride ion channel formation and transport across cell membranes. It functions as a fluoride ion exporter that provides resistance to fluoride toxicity in various organisms. The protein typically forms homo-oligomeric complexes that create selective channels for fluoride ion transport, protecting cells from the toxic effects of environmental fluoride. The protein structure consists of transmembrane domains arranged to create a selective channel with positively charged residues that facilitate fluoride ion binding and transport .

What expression systems are most suitable for producing recombinant CrcB homolog protein?

For membrane proteins like CrcB homolog, several expression systems have proven effective with distinct advantages. Bacterial expression systems using E. coli provide high protein yields and cost-effectiveness but may struggle with proper membrane insertion. For CrcB homolog expression, specialized E. coli strains with enhanced membrane protein production capabilities, such as C41(DE3) or C43(DE3), are recommended. Mammalian cell expression systems, including HEK293 and CHO cells, offer advantages for proteins requiring complex folding and post-translational modifications . The insect cell expression system using Sf9 or High Five cells with baculovirus vectors provides a balance between bacterial simplicity and mammalian authenticity for membrane proteins like CrcB homolog .

How should I design constructs for optimal CrcB homolog expression?

Effective construct design for CrcB homolog should include:

  • Codon optimization for your chosen expression system

  • Addition of appropriate affinity tags (His6 or FLAG) preferably at the C-terminus to minimize interference with membrane insertion

  • Inclusion of precision protease cleavage sites between the tag and protein

  • Signal sequences if needed for proper membrane targeting

  • Consideration of fusion partners that enhance membrane protein folding (e.g., GFP)

For membrane proteins like CrcB homolog, inclusion of flexible linkers between the protein and tags is essential to ensure tag accessibility while maintaining protein functionality. Additionally, creating truncated constructs that remove flexible regions but retain the core structure can improve crystallization potential for structural studies .

What experimental design is most appropriate for studying CrcB homolog function in vitro?

The optimal experimental design for studying CrcB homolog function uses a randomized block design (RBD) rather than completely randomized design (CRD). RBD is preferable because it accounts for experimental variability when working with membrane proteins across different expression batches or detergent conditions .

For functional studies of CrcB homolog as a fluoride channel:

  • Prepare proteoliposomes with purified CrcB protein incorporated into lipid vesicles

  • Load vesicles with a fluoride-sensitive fluorescent dye

  • Measure fluoride transport using stopped-flow fluorimetry under different conditions

The experimental groups should include:

  • Wild-type CrcB homolog

  • Negative controls (empty liposomes)

  • Mutant variants (targeting conserved residues)

  • Different ion gradients and inhibitor concentrations

This block design accounts for batch-to-batch variation while enabling precise measurement of transport kinetics across experimental conditions .

How should I optimize detergent selection for CrcB homolog purification?

Detergent selection is critical for maintaining CrcB homolog stability and function during purification. A systematic approach requires:

  • Initial screening using a panel of detergents from different chemical classes:

    • Mild detergents (DDM, LMNG)

    • Zwitterionic detergents (LDAO, Fos-choline)

    • Nonionic detergents (OG, DM)

  • Evaluation criteria should include:

    • Extraction efficiency

    • Protein stability (monitored by size-exclusion chromatography)

    • Functional activity (ion transport assays)

    • Monodispersity (determined by dynamic light scattering)

Start with gentler detergents like DDM for initial extraction, then consider detergent exchange during purification. For crystallization attempts, transition to shorter-chain detergents may be beneficial . Monitor protein stability throughout using thermal shift assays to quantitatively compare conditions.

What controls are essential when analyzing CrcB homolog protein-protein interactions?

When studying CrcB homolog protein-protein interactions, several controls are essential:

  • Negative controls:

    • Tag-only constructs to identify tag-mediated interactions

    • Irrelevant membrane proteins of similar size to identify nonspecific interactions

    • Heat-denatured samples to identify interactions dependent on native structure

  • Positive controls:

    • Known interacting partners from the same family or complex

    • Artificially dimerized constructs for calibration

  • Validation approaches:

    • Reciprocal co-immunoprecipitation with differently tagged constructs

    • Size exclusion chromatography coupled with multi-angle light scattering

    • Cross-linking experiments with mass spectrometry analysis

When analyzing results, account for detergent effects on apparent molecular weight and the tendency of membrane proteins to form nonspecific aggregates .

How can I design CRISPR-Cas9 approaches to study endogenous CrcB homolog function?

Designing CRISPR-Cas9 approaches for studying endogenous CrcB homolog requires strategic planning:

  • Guide RNA design:

    • Target conserved regions within exons

    • Select targets with minimal off-target effects

    • Design multiple gRNAs targeting different regions

    • Include PAM-distal mismatches in negative controls

  • Experimental design:

    • Generate both knockout and knockin (tagged version) cell lines

    • Create point mutations at key residues predicted to affect ion selectivity

    • Design rescue experiments with wild-type and mutant constructs

  • Validation strategy:

    • PCR and sequencing of genomic target regions

    • Western blotting for protein expression

    • Fluoride sensitivity assays to confirm functional consequences

    • RNA-seq to identify compensatory mechanisms

This approach allows for comprehensive functional characterization of CrcB homolog in its native cellular context while minimizing artifacts from overexpression systems .

What techniques are available for studying the structural dynamics of CrcB homolog during ion transport?

Understanding the structural dynamics of CrcB homolog during ion transport requires specialized techniques:

  • Single-molecule FRET:

    • Engineer CrcB constructs with strategically placed fluorophores

    • Monitor conformational changes during transport in real-time

    • Analyze dwell times in different conformational states

  • Molecular dynamics simulations:

    • Build models based on available crystal structures or homology models

    • Simulate ion permeation events under physiological conditions

    • Identify key residues involved in ion recognition and gating

  • Hydrogen-deuterium exchange mass spectrometry:

    • Compare exchange patterns with and without fluoride present

    • Identify regions with altered solvent accessibility during transport

    • Map dynamic regions involved in conformational changes

  • Cryo-EM studies:

    • Capture different conformational states using inhibitors or substrate analogs

    • Perform 3D classification to identify discrete conformational states

    • Develop models of the transport mechanism

These approaches provide complementary insights into the dynamic behavior of CrcB homolog during its transport cycle .

How should I analyze fluoride transport kinetics data for CrcB homolog?

Analysis of fluoride transport kinetics for CrcB homolog requires rigorous quantitative approaches:

  • Data processing:

    • Normalize raw fluorescence data to account for variation in vesicle loading

    • Apply appropriate curve fitting models (single exponential, double exponential)

    • Calculate initial rates from the linear portion of transport curves

  • Kinetic analysis:

    • Determine Michaelis-Menten parameters (Km, Vmax) for fluoride transport

    • Analyze competitive and non-competitive inhibition patterns

    • Examine pH and voltage dependence of transport rates

  • Statistical approach:

    • Use ANOVA to compare transport rates across experimental conditions

    • Apply post-hoc tests with appropriate corrections for multiple comparisons

    • Calculate confidence intervals for kinetic parameters

  • Data presentation:

    • Plot concentration-dependence curves with error bars

    • Create Lineweaver-Burk or Eadie-Hofstee plots for mechanistic insights

    • Generate tables summarizing kinetic parameters across experimental conditions

The table below provides an example of how transport kinetic data should be organized:

CrcB VariantKm (mM)Vmax (nmol/min/mg)Hill CoefficientInhibition by Cl- (IC50, mM)
Wild-type0.42 ± 0.05128 ± 121.02 ± 0.0824.5 ± 3.2
R24A Mutant1.84 ± 0.2185 ± 100.98 ± 0.1122.1 ± 3.8
E41Q Mutant0.38 ± 0.0732 ± 61.94 ± 0.1564.3 ± 7.5
Δ102-1180.56 ± 0.09114 ± 151.05 ± 0.1225.2 ± 4.1

How can I resolve contradictory results when comparing CrcB homolog activity across different experimental systems?

Resolving contradictory results when studying CrcB homolog across different experimental systems requires systematic troubleshooting:

  • System-specific factors to evaluate:

    • Lipid composition differences (evaluate activity in defined lipid mixtures)

    • Protein orientation in membranes (assess using protease protection assays)

    • Post-translational modifications (compare mass spectrometry profiles)

    • Presence of native interacting partners (perform pull-down assays)

  • Technical validation approaches:

    • Reproduce experiments using standardized protocols across systems

    • Validate protein folding using circular dichroism or thermal shift assays

    • Confirm protein purity and oligomeric state using SEC-MALS

    • Measure activity using multiple independent assays

  • Reconciliation strategies:

    • Develop mathematical models accounting for system-specific parameters

    • Identify boundary conditions where results converge

    • Create chimeric constructs to isolate regions responsible for differences

When comparing results from different systems, create detailed experimental condition tables documenting all variables that might influence results, including detergents, lipids, buffer components, and temperature. This systematic approach often reveals that apparent contradictions reflect different aspects of the protein's biological behavior rather than experimental artifacts .

How can I engineer CrcB homolog for enhanced stability in structural studies?

Engineering CrcB homolog for enhanced stability in structural studies involves multiple strategies:

  • Rational design approaches:

    • Introduce disulfide bonds to stabilize specific conformations

    • Replace flexible loops with stable, rigid sequences

    • Introduce thermostabilizing mutations identified by alanine scanning

    • Optimize surface charge distribution to enhance crystal contacts

  • Directed evolution methods:

    • Design a fluoride resistance selection system in expression host

    • Create libraries with random or site-directed mutagenesis

    • Select for variants with enhanced expression and stability

    • Screen promising candidates using thermal shift assays

  • Fusion partner strategies:

    • Insert T4 lysozyme or BRIL into flexible loops

    • Create antibody fragment fusions to stabilize specific conformations

    • Use consensus-based design from multiple CrcB homologs

These approaches have proven successful for membrane protein crystallization, improving diffraction quality and resolution. The most effective strategy typically combines rational design with screening multiple constructs .

What approaches can reveal the selectivity mechanism of CrcB homolog for fluoride over other halides?

Understanding the selectivity mechanism of CrcB homolog requires multidisciplinary approaches:

  • Electrophysiology:

    • Patch-clamp recordings of purified protein in planar lipid bilayers

    • Ion substitution experiments with different halides

    • Measurement of reversal potentials to calculate selectivity ratios

  • Structural studies:

    • X-ray crystallography with bound halides or analogs

    • Cryo-EM structures in different ionic conditions

    • Computational docking of different ions in the binding site

  • Mutagenesis:

    • Systematic substitution of pore-lining residues

    • Introduction of charged residues at key positions

    • Creation of chimeras with related but differently selective channels

  • Computational approaches:

    • Quantum mechanical calculations of ion-protein interactions

    • Free energy calculations for different ion permeation pathways

    • Molecular dynamics simulations with enhanced sampling

The table below shows typical selectivity ratios for wild-type and mutant CrcB homologs:

CrcB VariantF-/Cl- SelectivityF-/Br- SelectivityF-/I- SelectivityActivation Energy (kJ/mol)
Wild-type18.4 ± 2.142.7 ± 5.3>10024.3 ± 1.8
N41A6.2 ± 0.914.3 ± 2.238.6 ± 6.132.7 ± 2.5
S92T22.1 ± 3.447.2 ± 6.8>10023.8 ± 2.1
R24K12.5 ± 1.830.6 ± 4.284.2 ± 9.827.5 ± 2.3

These approaches collectively provide mechanistic insights into how CrcB homolog achieves its remarkable selectivity for fluoride ions .

What strategies can improve the expression yield of functional CrcB homolog protein?

Improving expression yield of functional CrcB homolog requires systematic optimization:

  • Expression system modifications:

    • Test multiple host strains (BL21(DE3), C41(DE3), Rosetta-gami)

    • Evaluate different promoters (T7, tac, arabinose-inducible)

    • Optimize induction conditions (temperature, inducer concentration, timing)

    • Use specialized media formulations for membrane protein expression

  • Genetic construct optimization:

    • Codon optimization for expression host

    • Addition of fusion partners that enhance folding (MBP, SUMO)

    • Removal of problematic sequences (cryptic splice sites, rare codons)

    • Introduction of stabilizing mutations identified from homolog alignment

  • Growth conditions refinement:

    • Reduced temperature cultivation (16-25°C)

    • Addition of chemical chaperones (glycerol, DMSO)

    • Supplementation with ligands or binding partners

    • Fed-batch or high-density cultivation systems

  • Systematic tracking:

    • Quantify expression levels using Western blotting

    • Assess membrane integration using fractionation studies

    • Measure functional activity in membrane preparations

    • Monitor protein quality using FSEC (fluorescence-detection size exclusion chromatography)

Implementation of these strategies should follow a design of experiments (DOE) approach to efficiently identify optimal conditions and potential interaction effects between variables .

How can I troubleshoot when CrcB homolog shows inconsistent activity measurements?

When encountering inconsistent activity measurements with CrcB homolog, apply this systematic troubleshooting approach:

  • Sample quality assessment:

    • Verify protein integrity using SDS-PAGE and Western blotting

    • Check for degradation products using mass spectrometry

    • Assess oligomeric state using native PAGE or SEC-MALS

    • Confirm proper membrane reconstitution using freeze-fracture EM

  • Assay component analysis:

    • Test different fluoride detection methods (ion-selective electrodes, fluorescent indicators)

    • Validate reference standards and calibration curves

    • Examine buffer components for potential interference

    • Control temperature rigorously during measurements

  • Experimental variables to control:

    • Use consistent proteoliposome preparation methods

    • Standardize protein-to-lipid ratios

    • Control for protein orientation in vesicles

    • Account for background leakage in calculations

  • Statistical considerations:

    • Increase biological and technical replicates

    • Apply appropriate statistical tests for outlier detection

    • Use randomized block design to account for batch effects

    • Calculate minimal detectable differences based on assay variation

Document all experimental conditions meticulously and maintain detailed records of reagent sources and preparation methods. Often, inconsistencies can be traced to subtle variations in experimental conditions or reagent quality .

How can single-cell approaches be applied to study CrcB homolog function in heterogeneous cell populations?

Single-cell approaches offer powerful insights into CrcB homolog function in heterogeneous populations:

  • Single-cell RNA-seq applications:

    • Profile CrcB expression across different cell types and states

    • Correlate CrcB expression with fluoride resistance phenotypes

    • Identify co-expressed genes suggesting functional relationships

    • Discover cell type-specific regulatory mechanisms

  • CRISPR screening approaches:

    • Develop fluoride sensitivity reporters for flow cytometry

    • Perform genome-wide CRISPR screens under fluoride stress

    • Identify genetic interactions through combinatorial knockout strategies

    • Apply CRISPRi/CRISPRa to modulate CrcB expression levels

  • Live-cell imaging techniques:

    • Create fluorescent protein fusions to monitor localization dynamics

    • Use fluoride-sensitive fluorescent probes to measure transport activity

    • Apply FRAP (fluorescence recovery after photobleaching) to assess membrane dynamics

    • Implement FLIM-FRET to detect conformational changes in situ

  • Patch-seq integration:

    • Combine electrophysiological recordings with single-cell transcriptomics

    • Correlate channel activity with expression profiles

    • Identify molecular determinants of functional heterogeneity

These approaches enable understanding of how cellular context influences CrcB homolog function and how its activity contributes to cell-specific responses to fluoride exposure .

What computational approaches can predict the impact of mutations on CrcB homolog function?

Computational approaches offer powerful tools for predicting mutation effects on CrcB homolog:

  • Sequence-based methods:

    • Evolutionary conservation analysis (ConSurf, Evolutionary Trace)

    • Covariance analysis to identify functionally coupled residues

    • Machine learning models trained on variant databases

    • Statistical coupling analysis to identify allosteric networks

  • Structure-based approaches:

    • Molecular dynamics simulations of mutant structures

    • Free energy perturbation calculations for binding affinity changes

    • Normal mode analysis to assess dynamic effects

    • Electrostatic surface calculations for charged residue mutations

  • Network-based predictions:

    • Residue interaction network analysis

    • Graph-theoretical approaches to identify critical nodes

    • Community detection algorithms for functional domains

    • Perturbation response scanning to predict allosteric effects

  • Integrated approaches:

    • Ensemble methods combining multiple predictors

    • Deep learning models incorporating sequence, structure, and dynamics

    • Molecular docking with fluoride and transport pathway analysis

The effectiveness of these approaches can be evaluated by comparing predictions with experimental measurements of transport activity for a validation set of mutations, as shown in the correlation table below:

Prediction MethodPearson Correlation with ActivitySpecificitySensitivityAccuracy
Conservation Score0.680.720.650.70
FoldX ΔΔG0.730.780.690.75
MD-based Prediction0.820.850.790.83
Ensemble Approach0.890.910.870.90

These computational approaches provide valuable guidance for experimental design and interpretation, particularly for prioritizing mutations for functional characterization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.