Recombinant Protein CysZ homolog (cysZ)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism and Ion Transport

CysZ mediates passive sulfate flux without coupling to ion gradients or ATP, distinguishing it from symporters and channels :

  • Substrate specificity: Binds sulfate (SO₄²⁻) with high affinity (EC₅₀ = 0.81 ± 0.045 μM) and is inhibited by sulfite (SO₃²⁻; IC₅₀ = 0.12 ± 0.034 μM) .

  • Electrophysiological behavior: Depolarization (inside-positive membrane potential) increases sulfate uptake by ~40% in proteoliposomes, suggesting co-permeation with cations (e.g., Na⁺) .

Assay TypeKey FindingsSource
Proteoliposome uptakeRapid SO₄²⁻ influx (peaks at 30 seconds)
SPA binding assaySO₃²⁻ outcompetes SO₄²⁻ with higher affinity
Membrane potentialDepolarization enhances sulfate flux

Recombinant Production and Host Systems

Recombinant CysZ homologs are produced in diverse hosts for functional and structural studies:

OrganismGene IDHost SystemPurity
Pseudomonas aeruginosaPA14_53330E. coli, Yeast≥85% (SDS-PAGE)
Haemophilus influenzaeN/AE. coli, Baculovirus≥85% (SDS-PAGE)
Vibrio cholerae (O1)N/AE. coli, Yeast≥85% (SDS-PAGE)
Escherichia coli (O7:K1)cysZE. coli≥85% (SDS-PAGE)

Optimization strategies:

  • Hypoxic conditions: Improved recombinant antibody production in P. pastoris under low oxygen, suggesting potential for enhancing CysZ yields .

  • Sequence sampling: Broad screening of bacterial homologs (e.g., Idiomarina loihiensis, Pseudomonas spp.) identified high-expression candidates .

Functional Challenges

  • Structural flexibility: Labile H4b-H5a hairpins complicate purification, necessitating detergent optimization .

  • Membrane integration: Inverted topology complicates topology prediction and functional reconstitution .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the protein according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cysZ; VP0798; Sulfate transporter CysZ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Target Names
cysZ
Target Protein Sequence
MKINNQQRTGFGYFLYGIQLALSPEIRRFVVLPLLANIILVGGAIFYLFSHLNMWIEGWI GQLPEFLSWLTYILWPLLALTILATFSYFFSTLANFIAAPFNGLLAEKVEETLTGKKIND DGFTAVLKDVPRVLAREWRKLLYILPKAIGLFLLLLIPALGQTVGPVLWFIFTAWMLAIQ YCDYPFDNHKIPFNDMRYKLKQKQGKAYGFGVLVSVFTTIPILNLIVMPVAICGATAMWV AEFKHQR
Uniprot No.

Target Background

Function
This protein is a high-affinity, high-specificity proton-dependent sulfate transporter responsible for mediating sulfate uptake. It provides the sulfur source for the cysteine synthesis pathway.
Database Links

KEGG: vpa:VP0798

STRING: 223926.VP0798

Protein Families
CysZ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is CysZ homolog and why is it significant in bacterial systems?

CysZ homolog is a membrane protein that functions as a sulfate (SO₄²⁻) permease, playing a critical role in sulfur metabolism. The gene encoding CysZ derives its name from its presence in the cysteine biosynthesis regulon. Its significance stems from its essential role in cellular sulfate uptake, which is vital for bacterial survival. Studies with E. coli K-12 strains containing cysZ deletions have demonstrated severe impairment in sulfate accumulation, rendering these bacteria non-viable in sulfate-free media without alternative sulfur sources such as thiosulfate (S₂O₃²⁻) . The protein represents a unique structural family without previously known precedent, making it both evolutionarily and functionally interesting for research into membrane transport mechanisms.

How does CysZ homolog differ across bacterial species?

CysZ homologs have been characterized from multiple bacterial species, with notable structural and functional studies conducted on variants from Idiomarina loihiensis (IlCysZ), Pseudomonas fragi (PfCysZ), Pseudomonas denitrificans (PdCysZ), and Vibrio parahaemolyticus . While the core function of sulfate transport is conserved, these orthologs exhibit differences in:

  • Oligomeric assembly patterns

  • Interface interactions between protomers

  • Sequence identity (e.g., PfCysZ and IlCysZ share 42% sequence identity)

  • Crystallization properties and space group formations

These differences provide valuable insights into the evolutionary adaptations of this transport system across bacterial phylogeny while maintaining the core function of sulfate uptake.

What are the typical expression and purification methods for recombinant CysZ homolog?

The expression and purification of CysZ homolog typically follows standard recombinant protein protocols with specific modifications to accommodate its membrane protein nature:

  • Gene cloning: The cysZ gene (e.g., VP0798 from V. parahaemolyticus) is cloned into an appropriate expression vector .

  • Expression system selection: Due to its prokaryotic origin, bacterial expression systems like E. coli are commonly employed, though the specific strain is selected based on codon optimization and membrane protein expression capabilities.

  • Induction conditions: Expression is typically induced under controlled temperature conditions (often reduced to 16-18°C) to facilitate proper membrane protein folding.

  • Membrane extraction: As CysZ is a membrane protein, extraction requires detergent solubilization of cell membranes after cell lysis.

  • Purification strategy: Affinity chromatography (utilizing histidine or other tags) followed by size-exclusion chromatography to isolate properly folded protein.

  • Buffer optimization: Final storage in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage .

For structural studies, additional steps include detergent screening and exchange to identify conditions that maintain the native oligomeric state while promoting crystal formation.

What is known about the three-dimensional structure of CysZ homolog?

CysZ homolog represents a novel protein fold with unique structural features:

  • Protomer structure: Each CysZ protomer contains transmembrane helical regions with characteristic hairpin motifs (H2-H3 and H4-H5) .

  • Oligomeric assembly: CysZ forms distinctive oligomeric assemblies, most notably as observed in PdCysZ, which assembles as a hexamer with nearly perfect D3 symmetry. This hexamer is arranged as a trimer of dimers with the three-fold axis perpendicular to the membrane plane .

  • Membrane topology: Perhaps most distinctively, CysZ exhibits an inverted transmembrane topology in its assembly, creating a dual-topology arrangement where both the periplasmic and cytoplasmic faces of the hexamer are essentially identical by symmetry .

  • Dimensional characteristics: The hexameric assembly forms a triangular face with sides measuring approximately 75 Å, with a perpendicular span of about 65 Å .

The structural determination of CysZ from multiple species required advanced crystallographic techniques, including selenium-methionine derivatization, multi-crystal native SAD, and molecular replacement approaches .

How do the dimeric interfaces of CysZ differ between species?

The dimeric interfaces of CysZ show notable differences between species, revealing evolutionary adaptations while maintaining functional transport:

SpeciesInterface RegionKey CharacteristicsBuried Surface Area
I. loihiensis (IlCysZ)H2-H3 helicesHead-to-tail conformation in membraneNot specified in source
P. fragi (PfCysZ)H4-H5 helicesInteraction between H4-H5 of each protomerNot specified in source
P. denitrificans (PdCysZ)Multiple interfaces in hexamerTrimer of dimers with D3 symmetry5,700 Ų total for hexamer

These different interface arrangements demonstrate how the same basic fold can adopt different quaternary structures while presumably maintaining similar transport functions. The interfaces appear to be stabilized through a combination of hydrophobic interactions within the membrane region and more polar contacts at the water-exposed surfaces .

What methods have been used to determine membrane topology of CysZ?

Researchers have employed several complementary techniques to determine the membrane topology of CysZ:

  • Cysteine accessibility methods: By introducing single cysteine mutations along the length of helix H4 and other regions, researchers assessed membrane insertion. For example, studies showed that only the R132C residue at the top of helix H4 was accessible to fluorophore labeling, indicating it was exposed outside the membrane while other residues were membrane-embedded .

  • Crosslinking studies: Cysteine mutations (such as L161C-A164C) that formed dimers under crosslinking conditions provided evidence for specific interfacial contacts between protomers .

  • Surface electrostatics analysis: Computational analysis of the electrostatic properties revealed a hydrophobic belt along the mid-section of the hexamer, clearly delineating the membrane-embedded regions .

  • Sequence conservation mapping: Analysis of multiple sequence alignments highlighted conserved regions likely to have structural and functional importance, providing indirect evidence for topology .

  • Crystallographic structures: The crystal structures themselves, particularly the hexameric assembly of PdCysZ, provided definitive evidence for the dual-topology arrangement with identical periplasmic and cytoplasmic faces .

These methodologies collectively established the unusual inverted transmembrane topology that characterizes the CysZ assembly.

How does CysZ mediate sulfate transport across bacterial membranes?

CysZ functions as a high-affinity, highly specific, pH-dependent SO₄²⁻ transporter. The transport mechanism appears to involve several key features:

  • Channel formation: The oligomeric assembly creates a pathway for sulfate ions to cross the membrane.

  • Substrate specificity: CysZ shows high specificity for sulfate ions over other anions.

  • pH dependency: Transport activity is influenced by pH gradients across the membrane.

  • Regulation by sulfite: The transport activity is directly regulated by SO₃²⁻ (sulfite), which is a toxic intermediate in the assimilatory pathway .

The unique inverted transmembrane topology and oligomeric assembly likely create a distinctive transport pathway different from other known ion channels or transporters. The precise mechanism of ion selectivity and gating remains an active area of investigation, but structural analysis suggests that conserved positively charged residues may play a role in sulfate recognition and transport .

What experimental approaches are used to measure CysZ-mediated sulfate transport?

Several complementary approaches have been employed to characterize CysZ-mediated sulfate transport:

  • Proteoliposome reconstitution assays: Purified CysZ protein is reconstituted into artificial liposomes, and sulfate uptake is measured using radioactive ³⁵S-labeled sulfate or fluorescent indicators .

  • Cellular uptake assays: Comparing sulfate accumulation in wild-type versus cysZ deletion strains provides evidence of transport function in intact bacterial cells .

  • Planar lipid bilayer electrophysiology: This technique allows direct measurement of ion currents through single channels, providing insights into the biophysical properties of transport .

  • pH-dependent transport studies: Measuring transport rates under varying pH conditions helps characterize the pH dependency of the transport mechanism .

  • Competition assays: Using various anions to compete with sulfate transport helps determine substrate specificity.

Each method provides different but complementary information about the transport properties, with proteoliposome reconstitution being particularly valuable for isolating CysZ activity from other cellular transporters.

How is CysZ transport activity regulated in bacterial cells?

CysZ transport activity is regulated through several mechanisms:

  • Transcriptional regulation: The cysZ gene is part of the cysteine biosynthesis regulon, suggesting coordinated expression with other genes involved in sulfur metabolism.

  • Feedback inhibition by sulfite: One of the most direct regulatory mechanisms is inhibition by SO₃²⁻ (sulfite), a downstream metabolite in the sulfate assimilation pathway. This creates a feedback loop that prevents excessive sulfate uptake when downstream metabolites accumulate .

  • pH sensitivity: The transport activity shows pH dependence, which may serve as an environmental regulatory mechanism.

  • Oligomeric state transitions: Though not fully characterized, changes in the oligomeric state (between dimeric and hexameric forms) could potentially serve as a regulatory mechanism.

These regulatory mechanisms ensure that sulfate uptake is coordinated with the cell's metabolic needs and prevents accumulation of potentially toxic intermediates like sulfite.

What are the optimal conditions for storing and handling recombinant CysZ homolog?

Optimal handling of recombinant CysZ homolog requires specific conditions to maintain structural integrity and function:

  • Storage temperature: Store at -20°C for regular use, or at -80°C for extended storage .

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended. Working aliquots should be stored at 4°C for up to one week .

  • Detergent considerations: When working with purified CysZ for functional studies, maintaining an appropriate detergent concentration above its critical micelle concentration is essential to prevent protein aggregation.

  • Reconstitution protocols: For functional studies in liposomes, specific lipid compositions and protein-to-lipid ratios need to be optimized.

Following these guidelines helps maintain the native structure and function of the recombinant protein, particularly important for membrane proteins like CysZ which are prone to aggregation and denaturation when removed from the membrane environment.

How can recombinant CysZ be used as a model system for studying membrane transport mechanisms?

Recombinant CysZ offers several advantages as a model system for studying fundamental aspects of membrane transport:

  • Novel fold representation: CysZ represents a previously uncharacterized structural family, providing insights into alternative evolutionary solutions to the challenge of ion transport .

  • Dual topology architecture: The unusual inverted transmembrane arrangement presents a unique opportunity to study how such architectures facilitate transport .

  • Oligomeric assembly diversity: The different oligomeric states observed across species (dimers, hexamers) allow comparative studies of how quaternary structure influences function .

  • Substrate specificity: The high specificity for sulfate transport provides a model for studying ion selectivity mechanisms.

  • Regulatory mechanisms: The regulation by sulfite offers a system for investigating allosteric regulation of transport proteins .

Experimental approaches may include:

  • Site-directed mutagenesis of conserved residues to identify those critical for transport

  • Chimeric constructs between different species to map functional domains

  • Single-molecule studies to capture transport dynamics

  • Computational simulations of ion permeation pathways

What protein-protein interaction studies can be performed with recombinant CysZ?

Several approaches can be employed to study protein-protein interactions involving CysZ:

  • Oligomeric state analysis:

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation

    • Native gel electrophoresis

    • Chemical crosslinking followed by mass spectrometry

  • Interface mapping:

    • Hydrogen-deuterium exchange mass spectrometry to identify protected regions

    • Site-directed mutagenesis of interface residues followed by functional assays

    • Disulfide crosslinking of engineered cysteines at predicted interfaces

  • Interactome studies:

    • Pull-down assays to identify bacterial proteins that interact with CysZ

    • Bacterial two-hybrid screenings

    • Label transfer approaches

  • Dynamics of assembly:

    • Fluorescence resonance energy transfer (FRET) between labeled CysZ monomers

    • Single-molecule tracking to observe assembly/disassembly events

These approaches can provide insights into how CysZ assembles into functional oligomers and potentially identify other cellular components that interact with CysZ to regulate its function or integrate it into broader metabolic networks.

How do mutations in conserved residues affect the structure-function relationship of CysZ?

Structure-function analysis of CysZ through mutagenesis reveals important insights about transport mechanisms:

RegionConserved ResiduesFunctional Impact When MutatedStructural Impact
Transmembrane helicesCharged residues in H2-H3Disruption of sulfate binding and transportMinimal effect on folding
Dimer interfaceHydrophobic residuesReduced oligomerizationShift toward monomeric species
Cytoplasmic loopsBasic residuesAltered pH sensitivityMinimal structural change
Periplasmic regionConserved motifsReduced regulatory response to sulfiteVariable effects on structure

Analysis of sequence conservation across CysZ homologs has identified regions of invariance that are likely to have structural and functional importance . Targeted mutations in these regions can help establish the molecular basis for:

  • Sulfate recognition and binding

  • The translocation pathway through the protein

  • The mechanism of sulfite-mediated regulation

  • The assembly of functional oligomers

Such mutational studies are particularly valuable when combined with functional transport assays in proteoliposomes and structural analysis to correlate specific residues with their functional roles.

What are the challenges in crystallizing membrane proteins like CysZ, and how can they be overcome?

Crystallizing membrane proteins like CysZ presents several specific challenges:

  • Detergent selection: Finding detergents that maintain native structure while promoting crystal contacts is critical. For CysZ, screening multiple detergents was necessary to obtain diffraction-quality crystals .

  • Lipid requirements: Some membrane proteins require specific lipids to maintain structural integrity. Co-crystallization with lipids or use of lipidic cubic phase methods may be necessary.

  • Conformational heterogeneity: Transport proteins often exist in multiple conformational states, creating heterogeneity that impedes crystallization. Stabilizing mutations or binding partners may lock the protein in one conformation.

  • Phase determination: As seen with CysZ, standard molecular replacement methods may fail even with homologous structures (~42% identity between PfCysZ and IlCysZ) . Alternative phase determination methods include:

    • Heavy atom derivatives

    • Selenomethionine incorporation for SAD/MAD phasing

    • Native SAD phasing

    • Multi-crystal averaging

  • Crystal packing: Membrane proteins have limited hydrophilic surfaces to form crystal contacts. Fusion partners like T4 lysozyme can increase hydrophilic surface area.

The successful crystallization of CysZ from multiple species required a combination of these approaches, including SeMet derivatization, multi-crystal native SAD, and careful optimization of crystallization conditions .

How might structural insights into CysZ inform the development of new antimicrobial strategies?

The unique structural and functional properties of CysZ offer several potential avenues for antimicrobial development:

  • Essential pathway targeting: Since CysZ is critical for sulfate uptake and subsequent cysteine biosynthesis, inhibiting it could starve bacteria of essential sulfur-containing compounds. E. coli with cysZ deletions showed severe growth impairment without alternative sulfur sources .

  • Structural uniqueness: The novel fold of CysZ without human homologs makes it a potentially selective target for antimicrobials with reduced risk of off-target effects.

  • Oligomeric interface disruption: Small molecules designed to interfere with the formation of functional CysZ oligomers could inhibit transport activity without having to compete with the natural substrate.

  • Allosteric site targeting: The regulatory mechanism involving sulfite binding suggests the presence of allosteric sites that could be targeted by small molecules.

  • Species-specific targeting: The structural differences observed between CysZ homologs from different bacterial species might enable the development of species-selective inhibitors, allowing for narrow-spectrum antimicrobials.

Structural data from crystallographic studies of CysZ provides a foundation for structure-based drug design approaches, including virtual screening of compound libraries against binding pockets identified in the CysZ structure and fragment-based drug discovery targeting critical functional regions.

What techniques beyond X-ray crystallography could provide additional insights into CysZ structure and dynamics?

Several complementary techniques could extend our understanding of CysZ beyond static crystal structures:

  • Cryo-electron microscopy (Cryo-EM): Particularly valuable for capturing different conformational states of CysZ that may represent distinct steps in the transport cycle. Cryo-EM doesn't require crystallization and can potentially resolve structures in more native-like lipid environments.

  • Nuclear magnetic resonance (NMR) spectroscopy: While challenging for full-structure determination of membrane proteins of CysZ's size, solution and solid-state NMR can provide valuable information about specific domains, dynamics, and ligand binding.

  • Molecular dynamics simulations: Computational approaches can model the dynamics of sulfate transport, water permeation, and conformational changes on timescales not accessible to experimental techniques.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Can map the dynamics and solvent accessibility of different regions of CysZ, particularly useful for identifying conformational changes upon substrate binding.

  • Single-molecule fluorescence techniques: Methods like FRET can track conformational changes in real-time, providing insights into the transport mechanism and oligomerization dynamics.

  • Electron paramagnetic resonance (EPR) spectroscopy: Site-directed spin labeling combined with EPR can measure distances between specific sites in the protein, helping to validate structural models and capture conformational changes.

These approaches would complement the existing crystallographic data to build a more comprehensive understanding of CysZ's structure-function relationships.

How does the evolutionary history of CysZ relate to its unique structural features?

The evolutionary history of CysZ presents an intriguing case study in membrane protein evolution:

  • Phylogenetic distribution: Analyzing the distribution of CysZ across bacterial phyla could reveal its evolutionary origin and subsequent diversification. The presence of CysZ in diverse species from Idiomarina to Pseudomonas to Vibrio suggests an ancient origin with functional conservation .

  • Structural novelty: The unique fold of CysZ without structural precedent raises questions about its evolutionary origins. Comparative analysis with distantly related transporters might reveal evolutionary relationships not apparent from sequence alone.

  • Oligomeric diversity: The different oligomeric states observed (dimers in IlCysZ and PfCysZ, hexamers in PdCysZ) suggest evolutionary plasticity in quaternary structure. Mapping these differences onto a phylogenetic tree could reveal the evolutionary trajectory of oligomeric transitions.

  • Functional specialization: Comparing transport kinetics and substrate specificity across homologs could reveal functional adaptations to different environmental niches.

  • Sequence conservation patterns: The surface representation of sequence conservation highlights regions of invariance that likely have structural and functional importance . These patterns can reveal evolutionary constraints and functionally critical residues.

Such evolutionary analysis could not only provide insights into CysZ's origins but also inform understanding of membrane protein evolution more broadly.

What is the relationship between CysZ and other sulfate transport systems in bacteria?

Bacteria have evolved multiple systems for sulfate uptake, raising questions about the specific niche and role of CysZ:

  • Comparative transport mechanisms: How does CysZ's transport mechanism differ from other bacterial sulfate transporters like SulT (an ABC transporter) or SulP (a SLC26-family transporter)? Does CysZ operate through a channel-like mechanism versus the alternating-access mechanism of transporters?

  • Regulatory coordination: Are different sulfate transport systems coordinately regulated, or do they respond to different environmental cues? The direct regulation of CysZ by sulfite suggests integration with metabolic status.

  • Expression patterns: Under what environmental conditions is CysZ preferentially expressed compared to other sulfate transporters? High-affinity transport may be more important under sulfate-limited conditions.

  • Kinetic properties: How do the transport kinetics (Km, Vmax) of CysZ compare to other sulfate transporters? This could reveal specialization for different concentration ranges of environmental sulfate.

  • Energetic coupling: Unlike ABC transporters that couple transport to ATP hydrolysis, the energetic driving force for CysZ-mediated transport remains to be fully characterized. Is it driven by ion gradients or membrane potential?

What are common issues in expressing and purifying functional CysZ, and how can they be addressed?

Researchers working with CysZ may encounter several challenges during expression and purification:

ChallengePossible CausesSolutions
Low expression yieldToxicity due to membrane protein overexpressionUse tightly controlled induction systems; lower induction temperature to 16-18°C; use specialized E. coli strains (C41, C43) designed for membrane protein expression
Protein aggregationImproper folding; detergent mismatchScreen multiple detergents; include glycerol in buffers; optimize solubilization conditions
Loss of oligomeric stateDetergent-induced dissociationUse milder detergents; add lipids during purification; crosslinking approaches to stabilize oligomers
Poor functional activityDenaturation during purification; loss of essential lipidsGentle purification conditions; supplement with specific lipids; reconstitution optimization
Heterogeneous sampleMultiple conformational statesAddition of substrate or inhibitors to stabilize one conformation; protein engineering to restrict conformational flexibility

The successful structural and functional characterization of CysZ from multiple species demonstrates that these challenges can be overcome with proper optimization. The use of multiple orthologues (IlCysZ, PfCysZ, PdCysZ) in parallel increases the chances of success, as different homologs may exhibit different biochemical properties and crystallization propensities .

How can the functionality of purified recombinant CysZ be verified?

Verifying the functional integrity of purified recombinant CysZ is critical before proceeding with structural or functional studies:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Size-exclusion chromatography to verify the expected oligomeric state

    • Thermal stability assays (differential scanning fluorimetry) to assess folding

  • Sulfate binding assays:

    • Isothermal titration calorimetry to measure sulfate binding affinity

    • Microscale thermophoresis as an alternative binding measurement

    • Fluorescence-based ligand binding assays using fluorescent sulfate analogs

  • Transport activity measurements:

    • Proteoliposome reconstitution followed by sulfate uptake assays

    • Planar lipid bilayer electrophysiology to measure ion currents

    • Stopped-flow spectroscopy to measure transport kinetics

  • Functional complementation:

    • Expression of the recombinant CysZ in cysZ-deletion bacterial strains to verify rescue of the sulfate uptake phenotype

These validation steps ensure that the purified protein retains its native structure and function, which is particularly important for membrane proteins that can easily lose function during extraction from the membrane environment and purification.

What controls should be included when designing functional assays for CysZ-mediated sulfate transport?

Robust functional assays for CysZ require appropriate controls:

  • Negative controls:

    • Empty liposomes without reconstituted protein

    • Heat-denatured CysZ to confirm activity requires properly folded protein

    • Non-functional CysZ mutants (identified from structure or conservation analysis)

  • Specificity controls:

    • Competition with non-radioactive sulfate to demonstrate specificity

    • Testing transport of other anions (phosphate, chloride) to confirm selectivity

    • Addition of known inhibitors of sulfate transport

  • System validation:

    • Inclusion of a well-characterized transport protein as a positive control

    • Verification of liposome integrity using impermeant markers

    • Confirmation of protein orientation in liposomes

  • Quantitative controls:

    • Standardization curves for quantitative measurements

    • Time-course measurements to ensure linearity during initial rate measurements

    • Protein concentration dependence to confirm that transport rates scale with protein amount

  • Environmental variable controls:

    • pH dependence measurements to confirm expected pH sensitivity

    • Testing effect of membrane potential using ionophores

    • Temperature dependence to establish optimal assay conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.