Recombinant Protein damX (damX)

Shipped with Ice Packs
In Stock

Description

Introduction

The damX gene, also known as urf74.3, is located upstream of the dam gene, which encodes DNA adenine methyltransferase, in the chromosomes of Escherichia coli and Salmonella enterica . The damX gene is the third gene in an operon comprising at least six additional genes with various functions: aroK, aroB, dam, rpe, gph, and trpS . Initially, DamX was identified as an unidentified reading frame at centisome 74.3 on the E. coli chromosome . Until recently, DamX was the only gene in the operon whose function remained unknown . Two functions have been attributed to DamX: participation in cytokinesis as a component of the septal ring and contribution to bile resistance .

Structure of DamX

DamX is highly conserved in E. coli and Salmonella (≈77% identity) . It is an inner membrane protein featuring a single transmembrane segment, an N-terminal cytoplasmic domain of approximately 100 amino acid residues, and a relatively large, unstructured C-terminal periplasmic domain of about 300 amino acids . The predicted molecular weight of DamX is around 46 kDa, but it migrates more slowly than expected in SDS polyacrylamide gels for unknown reasons . DamX harbors a conserved peptidoglycan-binding domain at its C-terminus, known as the SPOR domain, which is present in some septal ring components and is thought to be important for septal ring localization .

Transcription of damX in E. coli is driven by at least three promoters, named P1, P2, and P3 . All three promoters resemble a classical σ70-dependent promoter . P1 and P2 are located upstream of aroK, while P3 is inside the aroB coding sequence . P2 is the strongest promoter, followed by P1 and P3 . It has been proposed that P1 and P2 ensure basal levels of expression of the entire operon, while P3 may modulate the expression level of downstream genes . Two additional promoters (P4 and P5) have been identified in the E. coli damX-containing operon, but neither of them contributes to damX transcription. P4 is inside the damX coding sequence, while P5 is located in the intergenic region between damX and dam .

Function of DamX

Two functions have been attributed to DamX: participation in cytokinesis as a component of the septal ring and contribution to bile resistance .

E. coli cells, suggesting that DamX may be recruited to the septal ring early during septal ring assembly . The first step in the assembly of the septal ring is polymerization of FtsZ at the inner face of the cytoplasmic membrane, to form the Z ring . The Z ring then serves as a scaffold for the assembly of the remaining components . FtsZ is the only protein required for recruitment of DamX to the septal ring . In strains lacking functional components located downstream in the recruitment cascade, DamX still localizes to the septal ring .

Role in Infection

When the cell division protein DamX was deleted, the efficiency to infect a cell was significantly reduced to about 40%, suggesting that DamX considerably contributes to a highly productive T4 infection . Further analyses showed that DamX are genuine division proteins that contribute significantly to the cell constriction process .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
damX; Z4741; ECs4230; Cell division protein DamX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
damX
Target Protein Sequence
MDEFKPEDELKPDPSDRRTGRSRQSSERSERTERGEPQINFDDIELDDTDDRRPTRAQKE RNEEPEIEEEIDESEDETVDEERVERRPRKRKKAASKPASRQYMMMGVGILVLLLLIIGI GSALKAPSTTSSDQTASGEKSIDLAGNATDQANGVQPAPGTTSAENTQQDVSLPPISSTP TQGQTPAATDGQQRVEVQGDLNNALTQPQNQQQLNNVAVNSTLPTEPATVAPVRNGNASR DTAKTQTAERPATTRPARQQAVIEPKKPQATVKTEPKPVAQTPKRTEPAAPVASTKAPAA TSTPAPKETATTAPVQTASPAQTTATPAAGGKTAGNVGSLKSAPSSHYTLQLSSSSNYDN LNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPL RQVQADLK
Uniprot No.

Target Background

Function

Function: Non-essential cell division protein.

Database Links

KEGG: ece:Z4741

STRING: 155864.Z4741

Protein Families
DamX family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is DamX protein and what is its primary function?

DamX is a cell division protein found in bacteria that controls reversible cell morphology switching. In uropathogenic Escherichia coli (UPEC), DamX has been identified as a critical mediator of bacterial filamentation - a morphological adaptation wherein bacteria elongate without dividing . This process appears to be central to UPEC's pathogenesis, as it allows the bacteria to evade immune responses and adhere more effectively to host epithelium during infection . Unlike other filamentation pathways, the DamX-mediated process is reversible, enabling bacteria to dynamically adapt their morphology throughout the infection cycle.

The primary function of DamX involves regulating cell division processes, particularly in the context of pathogenesis. When DamX is deleted, UPEC loses its ability to undergo reversible filamentation both in laboratory conditions and in mouse infection models . Conversely, when DamX is overexpressed, it induces reversible filamentation, confirming its regulatory role in this morphological transformation .

Why is DamX significant in bacterial pathogenesis research?

DamX has emerged as a crucial factor in understanding bacterial adaptability during infection processes. Research indicates that DamX is essential for establishing robust urinary tract infections, highlighting its role as a virulence mediator . The protein's ability to control bacterial shape-shifting represents a sophisticated adaptation that contributes to pathogen success through several mechanisms:

  • Immune evasion: Filamentous bacteria may evade phagocytosis and other host defense mechanisms

  • Enhanced adhesion: Altered morphology may facilitate attachment to host tissues

  • Persistence: The ability to revert to normal morphology allows for continued replication and infection spread

The significance of DamX extends beyond basic bacterial physiology into potential clinical applications. Since DamX-mediated filamentation represents an alternative pathway to the more well-studied SulA-mediated FtsZ sequestration in E. coli uropathogenesis, it provides a novel target for developing antimicrobial strategies . Targeting DamX could potentially disrupt a critical aspect of UPEC's pathogenic lifecycle, offering new approaches to combat UTIs that affect millions of people worldwide.

How does DamX differ from other bacterial cell division regulators?

DamX represents a distinct pathway for bacterial cell shape control that operates independently from the classical SulA-mediated FtsZ sequestration mechanism . While both pathways can result in bacterial filamentation, they differ in several key aspects:

  • Reversibility: DamX-mediated filamentation is notably reversible, allowing bacteria to transition between morphotypes as needed during infection. This contrasts with some other filamentation mechanisms that may be more permanent or require specific conditions for reversal.

  • Regulation: DamX appears to be regulated as part of the pathogenic process rather than strictly in response to DNA damage (as is common with SulA induction).

  • Specificity to pathogenesis: The research suggests that DamX's role is particularly important in the context of infection, as demonstrated by the significant attenuation of virulence in DamX mutants during UTI models .

The discovery of this alternative pathway demonstrates the complex and redundant strategies bacteria have evolved to control their morphology in response to environmental conditions. Understanding these differences is crucial for researchers attempting to develop targeted anti-virulence strategies that might circumvent bacterial adaptation mechanisms.

What molecular mechanisms underlie DamX-mediated filamentation?

The molecular mechanisms through which DamX controls bacterial filamentation involve complex interactions with the cell division machinery. While the complete pathway hasn't been fully elucidated based on the available search results, several key aspects have been identified:

DamX likely interfaces with the bacterial divisome - the protein complex responsible for septum formation during cell division. When DamX function is altered (either through deletion or overexpression), normal septation is disrupted, resulting in filamentous growth where cells elongate but fail to divide properly .

The reversible nature of DamX-mediated filamentation suggests that this process is under tight regulatory control, potentially involving post-translational modifications or protein-protein interactions that can be rapidly modulated in response to environmental conditions. This contrasts with other filamentation mechanisms that may require new protein synthesis or degradation to reverse.

Further research is needed to map the complete signaling pathway connecting DamX activity to the core cell division machinery, particularly focusing on:

  • The upstream signals that regulate DamX activity during infection

  • Direct protein-protein interactions between DamX and other divisome components

  • Potential localization changes of DamX during the transition between normal and filamentous growth

How can researchers effectively study DamX function in different experimental models?

Studying DamX function requires a multi-faceted approach incorporating both in vitro and in vivo experimental models. Based on the available literature, several effective methodologies have emerged:

In vitro infection models: Researchers have successfully employed in vitro models that simulate conditions in the bladder to study DamX function . These models are valuable for initial investigations where targeted experiments might be challenging to perform in animal models. They allow for controlled manipulation of bacterial and host factors while providing a physiologically relevant context.

Genetic manipulation approaches: Both deletion mutants (ΔdamX) and controlled overexpression systems have proven valuable for investigating DamX function . When creating damX deletion mutants, researchers should verify the specificity of the mutation by complementation studies to confirm that phenotypic changes are specifically due to the absence of DamX rather than polar effects on adjacent genes.

Animal infection models: Murine models of cystitis have been successfully employed to study the role of DamX in UTI pathogenesis . These models allow researchers to observe the complex interactions between pathogens and the host immune system that cannot be fully recapitulated in vitro.

Microscopy techniques: Visualization of bacterial morphology changes is central to studying DamX function. Advanced microscopy approaches including time-lapse imaging can capture the dynamic process of filamentation and reversion.

When designing experiments to study DamX, researchers should consider combining these approaches to build a comprehensive understanding of its function across different experimental contexts.

What expression systems yield optimal results for recombinant DamX protein production?

The choice of expression system for recombinant DamX protein production depends on the specific research objectives, particularly regarding protein yield, post-translational modifications, and functional activity. Based on available data, several expression systems have been evaluated with distinct advantages and limitations:

Expression SystemYieldTurnaround TimePost-translational ModificationsRecommended Applications
E. coliHighShortLimitedStructural studies, antibody production, high-throughput assays
YeastHighModerateIntermediateFunctional studies requiring some eukaryotic modifications
Insect cellsModerateLongerAdvancedStudies requiring proper protein folding
Mammalian cellsLowerLongestMost completeActivity assays requiring native-like protein

For research requiring properly folded protein with appropriate post-translational modifications, expression in insect cells with baculovirus or mammalian cells is recommended . These systems can provide many of the modifications necessary for correct protein folding and maintaining the protein's activity, which might be critical for functional assays or structural studies that depend on native conformation.

The selection of an appropriate expression system should be guided by the specific research questions being addressed. For instance, structural studies might prioritize yield over modifications, while interaction studies might require a more natively folded protein.

What experimental design principles are critical when investigating DamX function?

When designing experiments to investigate DamX function, researchers should adhere to rigorous experimental design principles to ensure reliable and interpretable results. Several key considerations include:

Proper control groups: In true experimental designs investigating DamX, participants (bacterial strains or animal models) should be randomly assigned to either the control group or the experimental group . For example, when studying the effect of DamX deletion, compare the wild-type strain (control) with the ΔdamX strain (experimental) under identical conditions.

Variable manipulation: Experiments should involve deliberate manipulation of independent variables to observe effects on dependent variables . For DamX research, independent variables might include:

  • DamX expression levels (deletion, wild-type, or overexpression)

  • Environmental conditions (mimicking urinary tract conditions)

  • Host factors (presence of specific immune components)

The dependent variables often include bacterial morphology, virulence, colonization efficiency, or host response markers.

Randomization: Randomly distributing experimental units helps control for extraneous variables . In animal infection studies with DamX mutants, randomizing animals to treatment groups helps ensure that observed differences are attributable to DamX rather than other factors.

Replication: Multiple biological and technical replicates are essential to account for variability in biological systems and experimental procedures.

Systematic approach to hypothesis testing: Begin by defining clear research questions about DamX function, formulate testable hypotheses, and design experiments that can specifically address these hypotheses .

How can researchers quantify DamX-mediated filamentation and its reversibility?

Quantifying DamX-mediated filamentation requires robust methodologies that can accurately capture morphological changes and their dynamics. Several approaches can be employed:

Microscopy-based quantification:

  • Phase-contrast or differential interference contrast microscopy can be used to measure bacterial cell length and classify morphotypes (rod-shaped vs. filamentous)

  • Fluorescence microscopy with membrane stains can enhance visualization of cell boundaries

  • Time-lapse microscopy is particularly valuable for studying the reversibility of filamentation, allowing researchers to track individual cells as they transition between morphologies

Flow cytometry:

  • Forward scatter measurements can distinguish between normal and filamentous bacteria in population-level analyses

  • When combined with fluorescent reporters, flow cytometry can correlate filamentation with other cellular parameters

Quantitative metrics:

  • Length distribution analysis: Measuring the length of hundreds of cells to generate distribution histograms

  • Filamentation index: The ratio of filamentous to normal cells in a population

  • Reversibility rate: The percentage of filamentous cells that revert to normal morphology within a defined time period

Genetic reporters:

  • Constructing fluorescent reporters linked to cell division genes can provide insights into the timing and spatial organization of division events during filamentation and reversion

These quantitative approaches should be combined with genetic manipulation of DamX to establish causality. Comparative analysis between wild-type, ΔdamX mutants, and complemented strains provides the strongest evidence for DamX's specific role in the filamentation process .

What are the key considerations for in vivo studies of DamX function in UTI models?

In vivo studies using urinary tract infection models are essential for understanding the physiological relevance of DamX in pathogenesis. Researchers should consider several critical factors when designing these experiments:

Animal model selection:

  • Murine models of cystitis have been successfully used to study DamX function in UTIs

  • The model should recapitulate key aspects of human UTI pathophysiology, including immune response and tissue architecture

Infection protocol standardization:

  • Consistent inoculum preparation and delivery

  • Standardized bacterial growth conditions prior to infection

  • Controlled infection parameters (volume, concentration, timing)

Outcome measurements:

  • Bacterial burden quantification in urine, bladder, and kidneys

  • Microscopic examination of tissue sections for bacterial morphology in situ

  • Host response parameters (inflammation markers, immune cell infiltration)

  • Disease progression metrics (symptoms, tissue damage)

Temporal considerations:

  • Time course experiments to capture the dynamic nature of infection

  • Sampling at multiple timepoints to observe filamentation and reversion events

Comparative analyses:

  • Wild-type vs. ΔdamX mutant strains

  • Complemented mutants to confirm phenotype specificity

  • Strains with varying DamX expression levels to assess dose-dependent effects

Ethical considerations:

  • Use of appropriate animal numbers based on power calculations

  • Implementation of humane endpoints

  • Consideration of refinement approaches to minimize animal suffering

When interpreting results from in vivo studies, researchers should acknowledge the complexity of the host environment and consider how multiple factors might influence DamX function during infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.