Recombinant Protein dct-5 (dct-5)

Shipped with Ice Packs
In Stock

Description

Overview of Dopachrome Tautomerase (Dct)

Dopachrome tautomerase (Dct), also referred to as tyrosinase-related protein-2 (TRP-2), is a critical enzyme involved in melanin biosynthesis . Specifically, Dct catalyzes the conversion of dopachrome to 5,6-dihydroxyindole-2-carboxylic acid (DHICA), a precursor of eumelanins . The Dct gene encodes this protein, which facilitates the non-decarboxylative tautomerization of L-DOPAchrome to DHICA within the melanin synthesis pathway .

Key Functions and Significance

Dct's primary function is to contribute to melanin synthesis by converting dopachrome to DHICA, thereby promoting eumelanin production . Beyond this, Dct protects melanocytic cells from ultraviolet radiation and reactive oxygen species, enhancing cell viability . Research indicates that Dct is involved in melanoma cell phenotype-specific interactions, which can influence tumor progression, and it has been linked to resistance to certain chemotherapeutic agents in melanoma, highlighting its therapeutic relevance . Furthermore, Dct plays a role in retinogenesis and is associated with melanosome function and related disorders .

Regulation of Dct Expression

The regulation of Dct expression is a dynamic process influenced by factors such as MITF, ER-α, and chromatin remodelers, impacting cell proliferation and senescence in melanocytes .

Recombinant Protein Expression in E. coli

Escherichia coli (E. coli) is a widely used host for recombinant protein expression . Various approaches exist for synthesizing recombinant proteins in E. coli, with ongoing advancements in this field . The BL21(DE3) strain and its derivatives are commonly used for protein expression .

Some E. coli mutants are specifically selected to withstand the expression of toxic proteins . The strains C41(DE3) and C43(DE3) were identified in a screen to isolate BL21(DE3) derivatives with improved membrane protein overproduction characteristics . Mutations in the lacUV5 promoter in these strains reduce the level of T7 RNAP synthesis, making it more tolerable for the cell .

StrainCharacteristics
BL21(DE3)Most used strains for protein expression. λDE3 prophage inserted in the chromosome of BL21 and contains the T7 RNAP gene under the lacUV5 promoter .
AD494, OrigamiTMtrxB (thioredoxin reductase) mutants, enhancing disulfide bond formation in the cytoplasm. Origami strain also lacks the glutathione reductase gene .
HMS174recA mutant, positively affecting plasmid stability .
C41(DE3), C43(DE3)Selected to withstand expression of toxic proteins. Mutations in the lacUV5 promoter revert it to a weaker wild-type, reducing T7 RNAP synthesis .

Secretion Strategies for Recombinant Proteins

Secretion to the periplasm or the medium can be necessary for recombinant protein production . One option for periplasmic expression is the post-translational Sec-dependent pathway, where the recombinant protein is fused to a leader peptide, such as those from Lpp, LamB, LTB, MalE, OmpA, OmpC, OmpF, OmpT, PelB, PhoA, PhoE, or SpA proteins . The co-translational translocation machinery, based on the SRP (signal recognition particle) pathway, can also be utilized, employing signal sequences like that of disulfide isomerase I (DsbA) to target proteins to the periplasm .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
dct-5; CBG02399; Protein dct-5; Daf-16/foxo controlled, germline tumor affecting protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
dct-5
Target Protein Sequence
MGIFLGLVDSSSPKSSTSCSLMTSCAVEKCLNKDMVRKIVIESSREEVFGNLVEKFDMVC IAAKCGNECSQCKHCHYALEQMSALAQGEKTSGLCPKLETCVFNCLTEDVSKVLSCVATR CNVHCYDGDCPSCKMISRRIFSTICKQHSMTSQPQIKYEGTCPNLFMELADHYVAKKKL
Uniprot No.

Target Background

Function
Acts downstream of daf-16/foxo to suppress tumors induced by gld-1 disruption. It is potentially a direct target of daf-15/foxo.
Database Links

STRING: 6238.CBG02399

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Dopachrome tautomerase (Dct) and what is its role in melanin biosynthesis?

Dopachrome tautomerase (Dct), also known as tyrosinase-related protein-2 (TRP-2), is a critical enzyme in the melanin biosynthetic pathway. It specifically catalyzes the non-decarboxylative tautomerization of L-DOPAchrome to 5,6-dihydroxyindole-2-carboxylic acid (DHICA), which serves as a precursor for eumelanins. This enzymatic conversion is a key step in determining the quality and composition of melanin produced in melanocytes. Beyond its catalytic function, Dct plays protective roles against ultraviolet radiation and reactive oxygen species, enhancing cell viability in melanocytic cells .

The regulation of Dct expression involves multiple factors including MITF (Microphthalmia-associated transcription factor), ER-α (Estrogen Receptor alpha), and various chromatin remodelers, which collectively impact cell proliferation and senescence patterns in melanocytes. Research has also linked Dct to retinogenesis misregulation in albinism, highlighting its importance in melanosome function and related disorders .

How does recombinant Dct protein differ structurally and functionally from native Dct?

Recombinant Dct protein, when expressed in bacterial systems like Escherichia coli, lacks post-translational modifications present in mammalian cells, which can affect protein folding, stability, and enzymatic activity. While the primary amino acid sequence remains identical, differences in disulfide bond formation, glycosylation patterns, and protein folding machinery between prokaryotic and eukaryotic systems can lead to structural variations.

Functionally, these structural differences may manifest as altered catalytic efficiency, substrate specificity, or protein stability. Researchers often need to optimize expression conditions and purification protocols to obtain recombinant Dct with activity comparable to the native protein. In some cases, expression in eukaryotic systems may be necessary to preserve critical post-translational modifications essential for proper function .

What are the optimal expression conditions for recombinant Dct in E. coli systems?

The optimization of expression conditions for recombinant Dct in E. coli systems involves several key parameters that significantly impact protein yield and solubility. Based on studies with other multi-epitopic recombinant proteins, the following conditions typically yield optimal results:

ParameterOptimal ConditionImpact on Expression
E. coli strainBL21(DE3)Enhanced expression of T7 promoter-driven constructs
Induction agent1 mM IPTGOptimal induction of protein expression
Culture medium2XYT mediumSuperior growth and protein yield compared to LB
Post-induction time4 hoursBalanced protein yield and solubility
Temperature25-30°CReduced inclusion body formation

The use of 2XYT medium rather than standard LB medium significantly improves cell density and protein yield. The optimal induction time of 4 hours represents a balance between maximizing protein production and minimizing inclusion body formation. Purification using Ni-NTA column chromatography for His-tagged recombinant Dct typically yields protein concentrations of approximately 500 μg/ml .

How does mRNA accessibility at translation initiation sites affect recombinant Dct expression?

mRNA accessibility at translation initiation sites is a critical factor in determining the success of recombinant protein expression, including Dct. Recent comprehensive analysis of 11,430 recombinant protein expression experiments revealed that the accessibility of translation initiation sites, modeled using mRNA base-unpairing across Boltzmann's ensemble, significantly outperforms alternative predictive features for expression success .

The accessibility of the region spanning positions -25 to +16 relative to the start codon shows the strongest correlation with protein expression levels. This parameter, measured as "opening energy," provides a more robust prediction of expression outcomes than traditional metrics such as codon adaptation index (CAI) or GC content .

For recombinant Dct expression, optimizing the accessibility of translation initiation sites through synonymous codon substitutions in the first 9 codons can significantly improve expression levels without altering the amino acid sequence. Stochastic simulation models indicate that higher accessibility leads to higher protein production, though potentially at the cost of slower cell growth during overexpression .

What are the most effective purification strategies for recombinant Dct protein?

Effective purification of recombinant Dct protein typically employs affinity chromatography as the primary strategy, followed by additional purification steps based on specific research requirements. The following methodological approach yields highly purified recombinant Dct:

  • Affinity Chromatography: For His-tagged recombinant Dct, Ni-NTA affinity chromatography provides the initial purification step. Cell lysates are applied to Ni-NTA columns, washed with buffer containing low imidazole concentrations (20-40 mM) to remove non-specifically bound proteins, and eluted with higher imidazole concentrations (250-500 mM) .

  • Size Exclusion Chromatography: Following affinity purification, gel filtration separates monomeric Dct from aggregates or degradation products based on molecular size.

  • Ion Exchange Chromatography: This optional step further purifies Dct based on its charge properties, especially useful for removing contaminants with similar size but different charge characteristics.

  • Endotoxin Removal: For immunological studies, endotoxin levels must be reduced below 8 EU/ml using specialized columns or phase separation techniques .

  • Buffer Exchange and Concentration: Final preparation involves dialysis against appropriate storage buffer and concentration using centrifugal filter devices with appropriate molecular weight cut-offs (typically 30-50 kDa).

Western blotting confirmation using anti-His antibodies verifies the identity and integrity of the purified protein, which should appear as a distinct band at the expected molecular weight of approximately 23 kDa for partial recombinant Dct .

How can the enzymatic activity of recombinant Dct be accurately measured?

The enzymatic activity of recombinant Dct can be measured through several complementary approaches that assess its ability to convert dopachrome to 5,6-dihydroxyindole-2-carboxylic acid (DHICA). The most widely used methods include:

  • Spectrophotometric Assay: This approach monitors the decrease in absorbance at 475 nm, which corresponds to dopachrome consumption, or the increase in absorbance at 320 nm, corresponding to DHICA formation. The reaction is typically performed in phosphate buffer (pH 6.8-7.0) at 37°C with freshly prepared dopachrome substrate.

  • HPLC Analysis: High-performance liquid chromatography provides quantitative measurement of both substrate depletion and product formation. This method offers greater specificity and can distinguish between different reaction products.

  • Radioactive Substrate Assay: Using 14C-labeled dopachrome substrate, this highly sensitive method tracks the conversion to labeled DHICA through scintillation counting after separation by thin-layer chromatography.

Activity measurements should include appropriate controls, including heat-inactivated enzyme and reaction mixtures without enzyme. Enzyme activity is typically expressed as μmol of dopachrome converted per minute per mg of protein under standard conditions. Kinetic parameters (Km, Vmax) can be determined by varying substrate concentrations and applying Michaelis-Menten kinetics analysis.

How can recombinant Dct be utilized for targeted immune response studies?

Recombinant Dct protein can be strategically utilized for targeted immune response studies through conjugation to dendritic cell (DC)-specific antibodies, such as anti-DEC-205 monoclonal antibodies. This approach directs the antigen specifically to dendritic cells, which are professional antigen-presenting cells crucial for initiating effective immune responses.

The methodology for creating such immunotargeting conjugates involves:

  • Antibody Preparation: Monovalent anti-DEC-205 antibodies are oxidized at their carbohydrate residues using sodium periodate to create aldehyde functional groups .

  • Conjugation Process: Purified recombinant Dct protein is added to the oxidized antibodies, forming Schiff base intermediates. Sodium cyanoborohydride (5M) is used as a reducing agent to facilitate stable conjugation .

  • Purification of Conjugates: The antibody-protein conjugates are purified through dialysis using sterile PBS buffer (pH 7.2-7.4) and passed over Amicon centrifugal filter devices (cut-off 50 kDa) to remove unconjugated protein .

  • Verification: Successful conjugation is verified through SDS-PAGE, western blotting, and ELISA, typically showing smears of protein-antibody conjugates above 180 kDa .

This targeted delivery approach enhances immune responses by directly delivering Dct to DEC-205 positive dendritic cells, potentially improving vaccine efficacy. The technique can be particularly valuable for studying Dct as a melanoma-associated antigen in cancer immunotherapy research .

What mutations in Dct affect eumelanin/pheomelanin synthesis and what are their research implications?

Mutations in the Dct gene have significant effects on eumelanin/pheomelanin synthesis, providing valuable insights into melanin biochemistry and potential therapeutic applications. These mutations can affect the enzyme's catalytic activity, substrate specificity, or protein stability without necessarily altering intracellular trafficking of the mutant protein .

Key research findings regarding Dct mutations include:

  • Catalytic Domain Mutations: Alterations in the catalytic domain can reduce or eliminate the enzyme's ability to convert dopachrome to DHICA, leading to altered eumelanin/pheomelanin ratios. These mutations help elucidate structure-function relationships in the enzyme.

  • Regulatory Region Mutations: Mutations in promoter or enhancer regions affect Dct expression levels, rather than enzyme activity, providing insights into transcriptional regulation of melanin synthesis.

  • Trafficking-Independent Effects: Research has shown that many Dct mutations affect eumelanin/pheomelanin synthesis without disrupting intracellular trafficking of the mutant protein, suggesting that catalytic activity can be modulated independently of protein localization .

Research implications of these findings extend to:

  • Understanding the biochemical basis of pigmentation disorders

  • Developing targeted therapies for melanoma, as Dct has been implicated in melanoma cell phenotype-specific interactions and resistance to chemotherapeutic agents

  • Exploring Dct's role in protecting melanocytic cells from damage caused by ultraviolet radiation and reactive oxygen species

Why do recombinant proteins like Dct often fail to express in heterologous systems?

Approximately 50% of recombinant proteins fail to be expressed in heterologous host cells, including Dct in E. coli systems. This high failure rate stems from multiple interrelated factors that can be systematically addressed through optimization strategies:

  • mRNA Secondary Structure: The accessibility of translation initiation sites significantly impacts expression success. Analysis of 11,430 recombinant protein expression experiments revealed that mRNA base-unpairing across the Boltzmann's ensemble at translation initiation sites is a powerful predictor of expression outcomes .

  • Codon Usage Bias: Discrepancies between the codon usage preferences of the source organism (e.g., mouse for Dct) and the expression host (e.g., E. coli) can lead to translation stalling and reduced protein yields.

  • Protein Toxicity: Overexpression of foreign proteins can be toxic to host cells, particularly if the protein disrupts essential cellular processes or forms aggregates.

  • Protein Misfolding: Lack of appropriate chaperones or post-translational modifications in heterologous systems often leads to protein misfolding and degradation or inclusion body formation.

  • Proteolytic Degradation: Host cell proteases may recognize and degrade recombinant proteins, particularly if they contain sequences that mimic protease recognition sites.

Optimization strategies should focus on modifying the mRNA sequence to enhance translation initiation site accessibility while preserving the amino acid sequence through synonymous codon substitutions. Tools like TIsigner can modify up to the first nine codons of mRNAs to improve accessibility without altering protein sequence .

How can the solubility of recombinant Dct be improved during expression?

Improving the solubility of recombinant Dct during expression requires a multifaceted approach that addresses both expression conditions and protein characteristics:

StrategyImplementationMechanism
Lower expression temperatureReduce to 16-25°C post-inductionSlows protein synthesis rate, allowing proper folding
Optimize inductionUse 0.1-0.5 mM IPTG instead of 1 mMReduces expression rate, preventing aggregation
Co-expression with chaperonesCo-transform with plasmids encoding GroEL/GroES, DnaK/DnaJAssists proper protein folding
Fusion tagsExpress as MBP or SUMO fusionEnhances solubility through highly soluble partner proteins
Culture medium optimizationUse 2XYT or TB medium with glycerolProvides better growth conditions and osmotic balance
Lysis buffer optimizationInclude 0.1-1% Triton X-100 or NP-40Improves extraction of membrane-associated proteins

For Dct specifically, the use of 2XYT medium with 1 mM IPTG induction for 4 hours has proven effective in producing soluble protein . Additionally, the accessibility of translation initiation sites can be optimized through synonymous codon substitutions in the first 9 codons, which can significantly impact protein solubility without altering the amino acid sequence .

If these strategies prove insufficient, alternative approaches include expressing truncated functional domains of Dct rather than the full-length protein, or shifting to eukaryotic expression systems that may provide the post-translational modifications and folding machinery necessary for proper Dct folding and function.

How can recombinant Dct contribute to melanoma research and potential therapeutic applications?

Recombinant Dct holds significant potential for advancing melanoma research and therapeutic applications through several innovative approaches:

  • Tumor-Associated Antigen Studies: As Dct is expressed in melanocytes and melanoma cells, recombinant Dct can be used to develop and test melanoma vaccines. Conjugating purified Dct to dendritic cell-targeting antibodies like anti-DEC-205 directs the antigen specifically to professional antigen-presenting cells, potentially enhancing anti-tumor immune responses .

  • Resistance Mechanism Investigations: Dct has been implicated in melanoma cell resistance to certain chemotherapeutic agents. Recombinant Dct enables in-depth studies of these resistance mechanisms, potentially leading to strategies for overcoming treatment resistance .

  • Phenotype-Specific Interaction Analysis: The interaction of Dct with caveolin-1 in melanoma cells has been identified as phenotype-specific and potentially involved in tumor progression. Recombinant Dct provides a tool for dissecting these interactions at the molecular level .

  • Structural Studies for Drug Design: Purified recombinant Dct enables high-resolution structural studies through X-ray crystallography or cryo-electron microscopy, facilitating structure-based drug design targeting Dct or its interactions.

  • Biomarker Development: Recombinant Dct can be used to develop and standardize assays for detecting Dct as a biomarker in melanoma diagnosis, prognosis, or treatment response monitoring.

The combination of recombinant protein technology with advanced immunological approaches positions Dct as a valuable tool in translational melanoma research, potentially bridging the gap between basic science and clinical applications.

What are the emerging technologies for improving recombinant protein expression prediction and optimization?

Emerging technologies for improving recombinant protein expression prediction and optimization are revolutionizing how researchers approach protein production:

  • mRNA Structure-Based Prediction Tools: Advanced algorithms that model mRNA base-unpairing across the Boltzmann's ensemble significantly outperform traditional features in predicting expression success. These tools analyze the accessibility of translation initiation sites, which has been shown to be a critical determinant of expression outcomes in extensive studies of over 11,430 recombinant protein expression experiments .

  • Synonymous Codon Optimization Systems: Tools like TIsigner use simulated annealing to modify up to the first nine codons of mRNAs with synonymous substitutions, enhancing translation initiation without altering protein sequence. This approach recognizes that accessibility impacts regions beyond the immediate target, allowing modest changes to significantly impact expression levels .

  • Stochastic Simulation Models: Mathematical modeling of protein production dynamics reveals that higher accessibility leads to higher protein yields, though potentially at the cost of slower cell growth during overexpression. These models help predict the trade-offs between expression levels and host cell viability .

  • Machine Learning Integration: AI approaches combining multiple parameters (mRNA structure, codon usage, amino acid properties) can predict expression success with increasing accuracy, guiding experimental design before laboratory work begins.

  • High-Throughput Screening Platforms: Automated systems testing multiple expression constructs and conditions simultaneously accelerate optimization, particularly when coupled with rapid detection methods for protein expression and solubility.

These technologies collectively represent a shift from empirical trial-and-error approaches to rational, predictive design strategies for recombinant protein expression, significantly increasing success rates and reducing development time and costs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.