Recombinant Protein Ddg (lpxP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lpxP; ddg; SF2444; S2582; Lipid A biosynthesis palmitoleoyltransferase; Kdo(2-lipid IV(A palmitoleoyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Shigella flexneri
Target Names
lpxP
Target Protein Sequence
MFPQCKFSREFLHPRYWLTWFGLGVLWLWVQLPYPVLCFLGTRIGAMARPFLKRRESIAR KNLELCFPQHSAEEREKMIAENFRSLGMALVETGMAWFWPDSRVRKWFDVEGLDNLKRAQ MQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNQLMEWVQTRGRMRSNKAMIGRN NLRGIVGALKKGEAVWFAPDQDYGRKGSSFAPFFAVENVATTNGTYVLSRLSGAAMLTVT MVRKADYSGYRLFITPEMEGYPTDENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPVG ESSLYI
Uniprot No.

Target Background

Function

Catalyzes the transfer of palmitoleate from palmitoleoyl-acyl carrier protein (ACP) to Kdo(2)-lipid IV(A) to form Kdo(2)-(palmitoleoyl)-lipid IV(A).

Database Links

KEGG: sfl:SF2444

Protein Families
LpxL/LpxM/LpxP family, LpxP subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What Factors Affect mRNA Accessibility in Recombinant Protein Expression?

The accessibility of translation initiation sites has emerged as a critical factor in successful recombinant protein expression. According to analysis of 11,430 recombinant protein expression experiments, mRNA accessibility at the translation initiation site is a primary determinant of expression success .

Key findings include:

When optimizing recombinant protein expression, researchers should prioritize the accessibility of translation initiation sites over traditional optimization methods such as codon adaptation index (CAI) or tRNA adaptation index (tAI) .

How Do Host Systems Differ for Recombinant Protein Production?

Host selection significantly impacts protein yield, functionality, and post-translational modifications:

E. coli Expression Systems:

  • Advantages: Simple, fast, inexpensive, and robust, with expressed protein comprising up to 50% of total cellular protein

  • Best for: Non-glycosylated proteins, proteins without complex disulfide bonds

  • Limitations: Lack post-translational modifications, proteins may form inclusion bodies

Mammalian Cell Expression Systems:

  • Chinese Hamster Ovary (CHO) and Human Embryonic Kidney (HEK) cell lines are workhorses for therapeutic proteins

  • Advantages: Proper protein folding, appropriate post-translational modifications

  • Applications: Production of antibodies, growth factors, cytokines, hormones, and vaccines

  • Limitations: Higher cost, longer production time, more complex optimization

The choice depends on your protein's characteristics and intended application. For therapeutic applications requiring human-like post-translational modifications, mammalian systems are preferred despite higher costs .

What Strategies Can Improve Soluble Protein Expression?

Several approaches can enhance soluble protein expression:

Fusion Tags and Partners:

  • Traditional tags (MBP, GST, thioredoxin, NusA) improve solubility

  • Newer options include intrinsically disordered peptides (IDPs) like the NEXT tag from Hydrogenovibrio marinus

  • Synthetic IDPs (SynIDPs) outperform conventional tags like MBP and SUMO in some cases

Temperature Optimization:

  • Lower temperatures (25°C vs. 37°C) often increase soluble protein expression by slowing folding kinetics

  • Example: In a study of PdT protein expression, reducing temperature from 37°C to 25°C increased soluble protein yields

Expression Vector and Promoter Selection:

  • T7-based expression systems allow high-level expression but can cause metabolic burden

  • Tunable expression systems allow calibration of expression levels to prevent aggregation

Co-expression with Chaperones:

  • Co-expressing molecular chaperones facilitates proper protein folding

  • Particularly useful for proteins prone to aggregation or misfolding

How Can We Monitor and Quantify Recombinant Protein Production?

Accurate quantification is essential for optimizing expression conditions:

SDS-PAGE Analysis:

  • Relative quantification (RQ) through densitometry of protein bands

  • Can differentiate between soluble and insoluble fractions

  • Limited by sensitivity and dynamic range

Western Blotting:

  • Provides higher sensitivity and specificity for target proteins

  • Useful for proteins expressed at lower levels

Reporter Systems:

  • GFP fusion proteins allow real-time monitoring

  • Luciferase reporters provide sensitive detection of expression levels

Advanced Techniques:

  • Mass spectrometry-based quantification

  • Pulsed SILAC approaches for monitoring protein production and degradation rates

  • Example: Researchers used pulsed SILAC to track newly synthesized and previously labeled proteins in dendritic cells responding to lipopolysaccharide

How Can mRNA Secondary Structure Be Optimized for Enhanced Expression?

Optimizing mRNA secondary structure at the translation initiation site can dramatically improve protein yields:

Translation Initiation Site Accessibility:

  • Opening energies ≤12 kcal/mol correlate with successful expression

  • Accessibility can be modeled using the mRNA base-unpairing across Boltzmann's ensemble

Optimization Approaches:

  • Software tools like TIsigner use simulated annealing to identify synonymous substitutions that improve accessibility

  • Modifications limited to the first 9 codons can achieve nearly optimal accessibility

Experimental Results:

  • GFP variants with optimized accessibility showed 4-fold higher expression

  • Renilla luciferase variants with optimized accessibility (5.77 kcal/mol) showed higher expression compared to wild-type (13.15 kcal/mol)

  • In a case study of PdT protein, TIsigner optimization increased production 1.2-fold compared to non-optimized sequences

SequenceOpening Energy (kcal/mol)Relative Expression Level
Wild-type GFP13.151.0
Optimized GFP5.774.0
Wild-type RLuc13.151.0
Optimized RLuc5.771.5

How Do Protein Degradation Pathways Influence Recombinant Protein Yields?

Understanding and manipulating protein degradation is crucial for optimizing yields:

Key Proteases in E. coli:

  • ATP-dependent proteases: Lon, ClpAP, ClpYQ (HslUV)

  • Periplasmic proteases: DegP, OmpT, protease III

Protease Knockout Strategies:

  • Lon deletion can improve production of certain recombinant proteins

  • Multiple protease knockouts can increase yields significantly

    • Triple protease mutant (ΔhslVU-clpPX-lon) showed 5-fold increase in protein stability

    • Double mutant for cell envelope proteases (ΔDegP-Tsp) yielded 4.5 times more secreted fusion protein

Protein Sequence Determinants of Degradation:

  • N-terminal rule: Tryptophan, tyrosine, phenylalanine, arginine, and lysine at N-terminus destabilize proteins

  • C-terminal rule: Hydrophobic amino acids in last five positions decrease stability

  • Hydrophobic regions are preferred cleavage sites for Lon and Clp proteases

Alternative Approaches:

  • Heat shock response inhibition (ΔrpoH) reduces proteolysis more effectively than lon mutation

  • Co-expression of protease inhibitors (e.g., T4 phage pinA gene)

What Advanced Experimental Design Approaches Optimize Recombinant Protein Expression?

Design of Experiments (DoE) offers a systematic approach to optimize multiple parameters simultaneously:

Advantages of DoE over Traditional Methods:

  • Efficiently explores multidimensional parameter space with fewer experiments

  • Accounts for interaction effects between factors

  • Provides statistical models for predicting optimal conditions

Key DoE Methodologies:

  • Factorial designs: Systematically vary multiple factors in combination

  • Response surface methodology: Model the relationship between factors and responses

  • Screening designs: Identify significant factors for further optimization

Application to Recombinant Protein Production:

  • Example: A DoE approach developed process conditions achieving 250 mg/L of soluble pneumolysin (Ply) in E. coli

  • Parameters typically optimized include:

    • Temperature

    • Inducer concentration

    • Media composition

    • Timing of induction

    • Cell density at induction

Implementation Considerations:

  • Software packages facilitate DoE design and analysis

  • Requires clear definition of response variables and acceptable ranges for factors

  • Validation experiments confirm predicted optimal conditions

How Can We Balance Protein Production and Cellular Stress?

The concept of "metabolic burden" is central to optimizing recombinant protein expression:

Relationship Between Expression and Cell Growth:

  • Higher protein production often leads to slower cell growth

  • Stochastic simulation models show that higher accessibility leads to greater protein production but decreased growth rate

Strategies for Balancing Production and Stress:

  • CRISPR-based libraries of bacterial hosts with variable T7 RNA polymerase expression levels

  • Tunable plasmid replication systems to control gene copy number

  • Optimized translation efficiency by modifying ribosome binding sites

Contradictory Observations:

  • Some studies suggest slower translation may increase yields of correctly folded proteins

  • Others report that increased translation efficiency improves yields

  • These contradictions highlight the protein-specific nature of optimization

Experimental Approaches:

  • Monitoring growth curves alongside protein production

  • Measuring cellular stress markers (heat shock proteins, proteases)

  • Quantifying resources (ribosomes, tRNAs) allocated to recombinant vs. endogenous proteins

How Can Disulfide Bond Formation Be Enhanced in E. coli?

Several strategies can improve the production of disulfide bond-containing proteins:

Strain Engineering Approaches:

  • Origami strains with mutations in thioredoxin reductase (trxB) and glutathione reductase (gor)

  • Switchable systems that transition from reducing to oxidizing cytoplasm conditions

Co-expression Strategies:

  • Sulfhydryl oxidase (Erv1p) catalyzes disulfide bond formation

  • Disulfide bond isomerase (DsbC) corrects non-native disulfide bonds

Advanced Techniques:

  • Phosphate depletion-triggered oxidizing environment

  • Inducible degradation of reducing pathway enzymes using degradation tags

Experimental Results:

  • A switchable system yielded 100–800 mg/L of soluble nanobodies in shake flasks and >2 g/L in bioreactors

  • Performance was better at 37°C than 30°C, suggesting the system did not reach its "metabolic burden" limit

What Approaches Can Improve Glycosylation in Recombinant Protein Expression?

Engineering glycosylation pathways is crucial for therapeutic proteins:

CHO Cell Engineering for Optimized Glycosylation:

  • CRISPR/Cas9 multiplexing allows simultaneous knockout of multiple glycosyltransferases

  • Engineering aimed at achieving human-identical rather than human-similar glycosylation

Key Challenges:

  • Heterogeneous N-glycosylation

  • Lack of human alpha-2,6-sialylation in CHO cells

  • Presence of multiple glycosyltransferase isoforms

Engineering Approaches:

  • Disruption of undesired glycosyltransferases

  • Introduction of human-specific glycosyltransferases

  • Analysis of glycosyltransferase-isoform contributions to glycosylation

Impact on Cell Viability:

  • Some glycosylation engineering approaches can impact cell growth and viability

  • Balancing optimal glycosylation with cell fitness is essential

How Can We Use AI and Computational Tools to Predict Optimal Expression Conditions?

Emerging computational approaches can streamline optimization:

Prediction of Expression Success:

  • Machine learning models predict expression outcomes based on sequence features

  • mRNA accessibility shows the highest predictive power (AUC scores) compared to other sequence features

Stochastic Simulation Models:

  • Models incorporating cell growth, transcription, translation, and protein turnover

  • Simulation results show similar trends to experimental data (correlation of -0.75, P = 2.8 × 10^-9)

Integrated Optimization Platforms:

  • TIsigner optimizes mRNA accessibility through synonymous codon substitutions

  • Future platforms may integrate multiple predictive models for comprehensive optimization

Considerations When Using AI Tools:

  • Models require sufficient training data from uniform experimental conditions

  • Users should be aware of potential "illusion of mastery" issues when applying AI tools

  • Experimental validation remains essential for confirming computational predictions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.