Recombinant Protein dif-1 (dif-1)

Shipped with Ice Packs
In Stock

Description

Introduction to DIF-1

DIF-1 (Differentiation-Inducing Factor 1) is a polyketide-derived signaling molecule critical for orchestrating cellular differentiation in Dictyostelium discoideum, a model organism for studying multicellular development . It acts as a morphogen, regulating the differentiation of prestalk cells into stalk cells during the formation of fruiting bodies . Structurally, DIF-1 is a chlorinated bicyclic sesquiterpene, synthesized through a complex biosynthetic pathway involving polyketide synthases (PKS) and post-PKS modification enzymes .

Biosynthesis of DIF-1

DIF-1 biosynthesis relies on hybrid fatty acid synthase-polyketide synthase (FAS-PKS) enzymes encoded by steely genes (stlA and stlB) and terminal O-methyltransferase (dmtA) .

Key Enzymes and Their Roles

GeneProteinFunctionReference
stlASteely1Contributes to early developmental expression but not essential for DIF-1
stlBSteely2Synthesizes the polyketide skeleton of DIF-1 (acylphloroglucinol)
dmtAO-methyltransferaseCatalyzes terminal methylation to complete DIF-1 biosynthesis

Mechanism:

  1. Steely2 generates the polyketide precursor (PCP) through iterative condensation reactions .

  2. DmtA adds a methyl group to PCP, yielding DIF-1 .

  3. Disruption of stlB or dmtA abolishes DIF-1 production, leading to developmental defects (e.g., thin slugs, stalk-less culmination) .

Recombinant Production and Related Proteins

While DIF-1 itself is not typically produced via recombinant methods due to its complex polyketide structure, recombinant proteins critical to its biosynthesis and signaling are widely studied.

Recombinant Proteins in DIF-1 Research

ProteinFunctionHost SystemApplicationReference
Steely2Synthesizes DIF-1 polyketide skeletonE. coliIn vitro DIF-1 biosynthesis assays
DIF-binding proteinHigh-affinity receptor (Kd = 1.8 nM) for DIF-1 signalingD. discoideumBioassays, receptor-ligand studies
DimA/DimBbZIP transcription factors regulating DIF-1 target genesD. discoideumStudies on DIF-1-induced nuclear localization

Challenges:

  • Recombinant production of DIF-1 requires heterologous expression of stlA, stlB, and dmtA in hosts like E. coli, which lacks native polyketide modification systems .

  • Post-PKS modifications (e.g., chlorination) may necessitate additional enzymes or chemical synthesis .

Applications in Research

DIF-1 and its associated recombinant proteins are pivotal in studies of cellular differentiation, signaling, and cancer biology.

Key Applications

ApplicationOutcomeReference
Prestalk differentiation bioassaysDIF-1 induces stalk cell formation in vitro; used to validate receptor binding
Signaling pathway studiesDIF-1 triggers nuclear accumulation of DimA/DimB, activating prestalk-specific genes
Cancer researchDIF-1 analogs inhibit mammalian cell proliferation and induce differentiation

Example: DIF-1’s ability to inhibit cancer cell growth has led to preclinical trials for leukemia and lung cancer therapies .

DIF-1 Binding Kinetics

ParameterValueMethodReference
Binding affinity (Kd)1.8 nMRadioligand binding assay
Receptor sites/cell~1,100Scatchard analysis

Developmental Regulation:

  • DIF-binding activity peaks 2–4 hours post-aggregation, preceding prestalk-prespore patterning .

  • Cyclic AMP induces binding activity, linking DIF-1 signaling to early developmental cues .

DimA/DimB Nuclear Localization

ProteinDIF-1 Induction TimeLocalizationDependenceReference
DimA:GFP2–10 minutesRapid nuclear accumulationRequires DimB
DimB:GFP2–10 minutesRapid nuclear accumulationIndependent of DimA

Mechanism:

  • DIF-1 triggers phosphorylation-dependent nuclear import of DimA via DimB .

  • Mutations in DimB abolish DimA nuclear accumulation, disrupting prestalk gene repression .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dif-1; F49E8.5; Protein dif-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
dif-1
Target Protein Sequence
MSDVLLNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKE GFFALYKGMAAPLVGVSPLFAVFFGGCAVGKWLQQTDPSQEMTFIQNANAGALAGVFTTI VMVPGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPAS AAYLSVYEYLKKKFSGEGAQRTLSPGATLMAGGLAGIANWGVCIPADVLKSRLQTAPEGK YPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFFGLELTLAAFRYFGIGGHPT PSTEVVPLPHDE
Uniprot No.

Target Background

Function
Dif-1 appears to play a role in maintaining tissue differentiation during embryonic development but is not involved in its initiation.
Database Links

KEGG: cel:CELE_F49E8.5

STRING: 6239.F49E8.5.1

UniGene: Cel.8694

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is DIF-1 and what is its primary role in biological systems?

DIF-1 (Differentiation-Inducing Factor-1) is a prestalk inducer in the cellular slime mold Dictyostelium discoideum. It functions as a key signaling molecule that regulates cell fate determination during the development cycle. Research has demonstrated that DIF-1 primarily induces the differentiation of prestalk cells, which ultimately form the supporting stalk structure of the fruiting body in Dictyostelium . The molecular mechanism underlying DIF-1 signaling involves activation of multiple phosphorylation-dependent pathways, with notable effects on proteins such as STATc and DimB, which show rapid phosphorylation changes within minutes of DIF-1 exposure .

How does DIF-1 relate to other differentiation factors?

DIF-1 belongs to a family of differentiation-inducing factors, with research suggesting potential relationships to other signaling proteins like DIF-2. In some contexts, DIF-1 has been referred to as "Protein DIF-2," though this nomenclature varies across research publications . The DIF family of molecules represents important developmental regulators that coordinate cell differentiation processes through precise temporal and spatial signaling mechanisms. Unlike generalized growth factors, DIFs often exhibit highly specific effects on particular cell populations during defined developmental windows.

What are the standard methods for working with DIF-1 in laboratory settings?

Standard approaches for DIF-1-related research typically include controlled application of the factor to Dictyostelium cells that have been starved for approximately 5 hours to mimic early development conditions . Typical experimental protocols involve metabolic labeling techniques such as SILAC (Stable Isotope Labeling by Amino acids in Cell culture) to enable quantitative assessment of cellular responses. The carefully timed collection of samples following DIF-1 exposure is critical, with common sampling points at 1, 5, 8, and 15 minutes post-treatment to capture the dynamic phosphorylation changes that characterize the early response .

How should time-course experiments with DIF-1 be designed for optimal results?

Based on established research methodologies, optimal time-course experiments for studying DIF-1 responses should:

  • Begin with cells that have been metabolically labeled using SILAC to facilitate accurate quantification of protein changes .

  • Include a starvation period (typically 5 hours) in shaking culture to simulate early Dictyostelium development before DIF-1 treatment .

  • Incorporate strategic sampling at scientifically relevant timepoints (e.g., 1, 5, 8, and 15 minutes post-treatment) based on known kinetics of phosphorylation changes in key proteins like STATc and DimB .

  • Implement overlapping triplex experimental samples to construct a comprehensive temporal profile, such as using two experimental samples: A (0, 1, 8 min) and B (0, 5, 15 min) .

  • Include biological triplicates for each experimental condition to ensure statistical robustness and reproducibility .

This design enables researchers to capture both immediate and slightly delayed responses to DIF-1 exposure, providing insights into the temporal dynamics of downstream signaling events.

What statistical considerations are most important when designing DIF-1 experiments?

When designing experiments involving DIF-1, several statistical principles must be carefully considered:

  • Clear identification of independent variables (e.g., DIF-1 concentration, exposure time) and dependent variables (e.g., phosphorylation levels, gene expression changes) .

  • Establishment of appropriate control variables that must remain constant to prevent external factors from influencing results .

  • Planning experimental conditions under statistically optimal parameters given resource constraints .

  • Ensuring validity, reliability, and replicability through proper experimental controls and documentation .

  • Achieving sufficient statistical power and sensitivity to detect biologically meaningful effects .

Implementation of these principles helps ensure that experimental outcomes can be confidently attributed to DIF-1 treatment rather than technical or biological variability.

How can DIF-1 experiments be designed to distinguish between uniform and non-uniform cellular responses?

To distinguish between uniform and non-uniform cellular responses to DIF-1, researchers can adapt statistical approaches similar to those used in differential item functioning (DIF) analysis in other fields:

  • Implement a sequential modeling strategy by first establishing baseline cellular responses, then introducing DIF-1 as a group variable, and finally examining interaction effects .

  • Calculate appropriate statistical measures (e.g., Chi-squared values) to evaluate the significance of both uniform responses (consistent across cell populations) and non-uniform responses (varying between subpopulations) .

  • Quantify effect sizes for both uniform and non-uniform responses to determine their biological significance .

  • Consider implementing logistic regression-based approaches that can simultaneously test for both uniform and non-uniform response patterns .

This methodological framework allows researchers to detect heterogeneity in cellular responses to DIF-1 that might otherwise be obscured in analyses focused solely on average population effects.

What are the recommended approaches for phosphoproteomics analysis in DIF-1 studies?

For comprehensive phosphoproteomics analysis in DIF-1 research, the following hierarchical classification system has proven effective:

  • Class IV sites: Phosphorylation sites showing substantial magnitude of change (ratio of ≥2 or ≤0.5) following DIF-1 treatment .

  • Class III sites: Phosphorylation events observed at each time point within a single biological replicate, enabling temporal curve plotting .

  • Class II sites: Phosphorylation changes observed in multiple biological replicates at the same time point (typically with average 1.5-fold change) .

  • Class I sites: Phosphorylation events observed consistently across all time points in multiple biological replicates, providing the most reliable temporal patterns .

This classification approach enables researchers to prioritize phosphorylation events based on both magnitude of change and reproducibility, facilitating the identification of the most biologically significant responses to DIF-1 treatment.

How can recombinant protein technology be leveraged for DIF-1 research?

Recent advances in recombinant protein bioprocessing offer several strategies that can be applied to DIF-1 research:

  • Optimization of expression systems for the production of proteins involved in DIF-1 signaling pathways, including careful selection of host organisms and expression vectors .

  • Implementation of periplasmic expression systems in E. coli, which has proven effective for the production of certain signaling proteins due to favorable adaptation of the bacterial proteome .

  • Combining signal peptide and production rate screening to enhance yields of recombinant proteins related to DIF-1 signaling cascades .

  • Scale-up of secretion systems for larger-scale production of DIF-1-related proteins for functional studies .

These approaches can facilitate the production of sufficient quantities of high-quality proteins for structural and functional analyses of DIF-1 signaling components.

What are common challenges in phosphorylation studies with DIF-1 and how can they be addressed?

Common challenges in DIF-1 phosphorylation studies include:

  • Signal-to-noise ratio limitations: Address by implementing the tiered classification system (Classes I-IV) to filter phosphorylation events based on magnitude and reproducibility .

  • Temporal resolution constraints: Overcome by designing overlapping experimental samples that collectively provide comprehensive temporal coverage .

  • Technical variability between replicates: Mitigate through multiple biological replicates (typically triplicates) and appropriate normalization procedures .

  • Difficulty distinguishing primary from secondary effects: Address by focusing on early time points (1-5 minutes) to capture immediate responses before secondary signaling cascades are activated .

Implementation of these strategies helps ensure robust and reproducible results in phosphorylation studies involving DIF-1.

How can variability between experimental replicates be managed in DIF-1 research?

To effectively manage variability between experimental replicates in DIF-1 research:

  • Employ metabolic labeling techniques like SILAC to minimize technical variability during sample preparation and analysis .

  • Implement rigorous standardization of cell culture conditions, including consistent starvation periods before DIF-1 treatment .

  • Utilize overlapping experimental designs where key time points (e.g., 0 minutes) are included in multiple experimental sets to provide internal consistency checks .

  • Apply increasingly stringent filtering criteria based on reproducibility across biological replicates to identify the most reliable phosphorylation changes .

  • Consider statistical approaches from experimental design literature to plan the experiment under optimal conditions given resource constraints .

These approaches collectively enhance reproducibility and reliability in DIF-1 research, enabling more confident interpretation of experimental results.

What new insights have emerged regarding DIF-1 signaling mechanisms?

Recent phosphoproteomics studies have revealed several important insights about DIF-1 signaling:

  • The DIF-1 response involves rapid phosphorylation changes occurring within minutes of exposure, with distinct temporal patterns emerging across different proteins .

  • Both STATc and DimB show characteristic phosphorylation changes following DIF-1 treatment, confirming their roles in the early signaling response .

  • The phosphorylation response can be classified into distinct categories based on magnitude and temporal dynamics, suggesting complex, multi-layered signaling networks .

Table 1: Classification of phosphorylation sites in response to DIF-1

ClassDefinitionBiological Significance
Class ISites observed at all time points in multiple replicatesHighest confidence markers of DIF-1 response
Class IISites observed in multiple replicates at same time pointStrong indicators of DIF-1 signaling
Class IIISites observed at each time point in single replicatePotential components of DIF-1 pathway
Class IVSites with ≥2-fold or ≤0.5-fold changeHigh-magnitude responders to DIF-1

These findings provide a framework for understanding the complex signaling networks activated by DIF-1 during cellular differentiation processes.

How is DIF-1 research contributing to broader understanding of developmental biology?

DIF-1 research has significant implications for developmental biology and cellular differentiation:

  • The study of DIF-1 signaling provides insights into the molecular mechanisms underlying cell fate determination during multicellular development .

  • The phosphoproteomics approaches developed for DIF-1 research offer methodological frameworks that can be applied to other developmental signaling systems .

  • Understanding the temporal dynamics of phosphorylation changes induced by DIF-1 informs broader principles of how cells interpret and respond to differentiation signals .

These contributions highlight the importance of DIF-1 research not only for understanding Dictyostelium development but also for elucidating general principles of cellular differentiation applicable across biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.