Recombinant Protein dipZ (dipZ)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Protein dipZ (dipZ)

DipZ is a bacterial cytoplasmic membrane protein that performs the critical function of transferring reducing power from the cytoplasm to the periplasm. This electron transfer capability facilitates the formation of correct disulphide bonds and c-type cytochromes in the periplasmic compartment . As a transmembrane protein, dipZ serves as an essential link in redox homeostasis pathways within bacterial cells, particularly in Escherichia coli where it has been extensively studied.

Recombinant production of dipZ has become increasingly important for research purposes, allowing scientists to investigate its structural features and functional mechanisms. The recombinant form of this protein can be produced through various expression systems, each offering distinct advantages for different research applications .

Domain Organization and Topology

Topological analysis using gene fusion techniques has revealed that dipZ possesses a complex multi-domain structure. The protein contains:

  • A highly hydrophobic central domain comprising eight transmembrane alpha-helices

  • Periplasmic globular N-terminal domain

  • Periplasmic globular C-terminal domain

  • An additional N-terminal alpha-helix that acts as a cleavable signal peptide

The experimentally determined translational start position indicates that the mature protein's N-terminus is located in the periplasm, following cleavage of the signal peptide . This topology is essential for the protein's function in transferring electrons across the cytoplasmic membrane.

Conserved Cysteine Residues

One of the most remarkable features of dipZ is the presence of three pairs of highly conserved cysteine residues. These pairs are distributed across the protein:

  • One pair in the hydrophobic central domain

  • One pair in the N-terminal periplasmic domain

  • One pair in the C-terminal periplasmic domain

Site-directed mutagenesis studies have demonstrated that all six conserved cysteine residues contribute significantly to dipZ function . These cysteine residues likely participate in redox reactions and may form disulfide bridges that are crucial for the protein's electron transfer capabilities.

Bacterial Expression Systems

Escherichia coli represents the most commonly used expression system for recombinant dipZ production. As dipZ is naturally found in E. coli, this homologous expression system provides several advantages:

  • High protein yields

  • Shorter turnaround times compared to eukaryotic systems

  • Cost-effectiveness and ease of culturing

Yeast Expression Systems

Yeast-based expression systems offer an alternative approach for producing recombinant dipZ with several benefits:

  • Good protein yields

  • Relatively short production timeframes

  • Eukaryotic post-translational processing capabilities

  • Effective membrane protein expression

Species such as Saccharomyces cerevisiae and Pichia pastoris are commonly employed for membrane protein expression due to their ability to perform certain eukaryotic post-translational modifications while maintaining relatively high expression levels.

Advanced Eukaryotic Expression Systems

For applications requiring more complex post-translational modifications, higher-order eukaryotic expression systems can be employed:

  • Insect cells with baculovirus expression vectors

  • Mammalian cell culture systems

These advanced systems provide sophisticated post-translational modification capabilities that may be necessary for maintaining proper protein folding and functional activity of dipZ . While these systems typically yield less protein and require longer production times, they may be essential for specific research applications requiring fully functional dipZ protein with native-like characteristics.

Table 2: Comparison of Expression Systems for Recombinant dipZ Production

Expression SystemRelative YieldTurnaround TimePost-translational ModificationsCost
E. coliHighShortLimitedLow
YeastMedium-HighMediumModerateMedium
Insect CellsMediumMedium-LongAdvancedHigh
Mammalian CellsLow-MediumLongComprehensiveVery High

Electron Transfer Function

The primary role of dipZ is to facilitate the transfer of reducing power (electrons) from the cytoplasm to the periplasm in bacterial cells . This transference is crucial for maintaining the proper redox balance between cellular compartments. The electron transfer capability of dipZ likely involves the conserved cysteine residues, which may participate in thiol-disulfide exchange reactions.

Role in Disulfide Bond Formation

By transferring reducing equivalents to the periplasm, dipZ plays a critical role in facilitating the formation of correct disulfide bonds in periplasmic proteins . Disulfide bonds are essential for the proper folding, stability, and function of many secreted and periplasmic proteins in bacteria. The redox environment established partially through dipZ activity helps ensure that these bonds form appropriately.

Cytochrome Maturation

Another significant function of dipZ is its contribution to the formation of c-type cytochromes in the periplasmic space . These cytochromes are essential components of bacterial electron transport chains and require specific redox conditions for proper heme attachment and protein maturation. DipZ helps establish the necessary reducing environment for these processes.

Table 3: Functional Roles of dipZ in Bacterial Cells

FunctionMechanismPhysiological Significance
Electron TransferTransports reducing equivalents across membraneMaintains redox homeostasis between compartments
Disulfide Bond FormationProvides reducing power for thiol-disulfide exchangeEnsures proper folding of periplasmic proteins
Cytochrome MaturationEstablishes appropriate redox environmentSupports electron transport chain assembly
Redox SensingPotential role in monitoring cellular redox stateMay contribute to bacterial stress responses

Purification Strategies for Recombinant dipZ

Purification of recombinant dipZ presents challenges common to membrane proteins due to its hydrophobic nature and complex domain structure. Typical purification strategies include:

  1. Membrane fraction isolation from host cells

  2. Solubilization using appropriate detergents

  3. Affinity chromatography (often using engineered affinity tags)

  4. Size exclusion or ion exchange chromatography for final purification

The selection of appropriate detergents is particularly critical for maintaining the structural integrity and functional activity of dipZ during the purification process. The eight transmembrane segments in the central domain require careful handling to prevent protein aggregation or denaturation.

Current Research Applications

Recombinant dipZ is valuable for multiple research applications:

  • Structural studies of membrane protein architecture

  • Investigation of bacterial redox processes

  • Functional analysis of electron transfer mechanisms

  • Protein engineering approaches targeting redox-active proteins

Potential Biotechnological Applications

The unique properties of dipZ suggest several potential biotechnological applications:

  • Development of redox-sensitive biosensors

  • Engineering of electron transfer systems in synthetic biology

  • Potential antimicrobial drug targets, given its essential role in bacterial physiology

Future Research Directions

Several areas warrant further investigation regarding recombinant dipZ:

  • High-resolution structural determination using cryo-electron microscopy or X-ray crystallography

  • Detailed mechanistic studies of electron transfer pathways

  • Investigation of dipZ homologs across diverse bacterial species

  • Development of optimized expression and purification protocols for enhanced yield and activity

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
dipZ; BQ2027_MB2899; Protein DipZ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-695
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
dipZ
Target Protein Sequence
MVESRRAAAAASAYASRCGIAPATSQRSLATPPTISVPSGEGRCRCHVARGAGRDPRRRL RRRRWCGRCGYHSHLTGGEFDVNRLCQQRSRERSCQLVAVPADPRPKRQRITDVLTLALV GFLGGLITGISPCILPVLPVIFFSGAQSVDAAQVAKPEGAVAVRRKRALSATLRPYRVIG GLVLSFGMVTLLGSALLSVLHLPQDAIRWAALVALVAIGAGLIFPRFEQLLEKPFSRIPQ KQIVTRSNGFGLGLALGVLYVPCAGPILAAIVVAGATATIGLGTVVLTATFALGAALPLL FFALAGQRIAERVGAFRRRQREIRIATGSVTILLAVALVFDLPAALQRAIPDYTASLQQQ ISTGTEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDL KSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAK GAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQL LNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSL AANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPIS GPPTTHQVVAGDRLASETLEVRPSKGLQVFSFTYG
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is dipZ and what is its primary function in bacterial cells?

DipZ is a bacterial cytoplasmic membrane protein found in Escherichia coli and other bacteria that facilitates the transfer of reducing power from the cytoplasm to the periplasm. Its primary function is to enable the formation of correct disulfide bonds and c-type cytochromes in the periplasmic compartment . This protein plays a critical role in maintaining proper redox balance between cellular compartments and ensuring the correct folding and assembly of periplasmic proteins containing disulfide bonds. The transfer of reducing equivalents across the membrane is essential for various cellular processes, particularly in the biogenesis of proteins that require disulfide bonds for their structural integrity and function.

What are the conserved domains and critical residues in dipZ?

DipZ contains three pairs of highly conserved cysteine residues that are essential for its function:

  • One pair in the hydrophobic central domain

  • One pair in the periplasmic N-terminal globular domain

  • One pair in the periplasmic C-terminal globular domain

Site-directed mutagenesis studies have demonstrated that all six of these conserved cysteine residues contribute significantly to dipZ function . These cysteine residues are likely involved in redox reactions and electron transfer processes that enable dipZ to move reducing power from the cytoplasm to the periplasm. The conservation of these residues across bacterial species highlights their functional importance in the protein's mechanism of action.

What expression systems are suitable for producing recombinant dipZ?

E. coli remains the preferred expression system for recombinant dipZ due to its compatibility with membrane protein expression and the native environment for dipZ function. When expressing dipZ, researchers should consider the following approaches:

  • Using E. coli strains optimized for membrane protein expression (such as C41/C43 or Lemo21)

  • Employing inducible promoter systems with careful control of induction conditions

  • Considering fusion tags that can enhance solubility while minimizing interference with transmembrane domains

Experimental design approaches have shown that optimizing expression conditions can significantly impact yield and functionality of recombinant membrane proteins. For instance, studies with other recombinant proteins have achieved yields of up to 250 mg/L using carefully designed expression conditions in E. coli . For dipZ, similar methodological optimization would be required, with special attention to its membrane-associated nature.

What purification strategies work best for recombinant dipZ?

Purifying membrane proteins like dipZ presents unique challenges that require specialized approaches:

  • Membrane extraction: Use of appropriate detergents (such as n-dodecyl-β-D-maltoside or LDAO) to solubilize dipZ from bacterial membranes without denaturing its structure

  • Affinity chromatography: Utilizing engineered affinity tags (His, FLAG, etc.) for initial capture, with tag placement carefully designed to avoid interfering with transmembrane regions

  • Size exclusion chromatography: For final purification and to verify the homogeneity of the preparation

The selection of detergents is critical for maintaining protein stability and function throughout the purification process. For dipZ, which has eight transmembrane domains, detergent screening should be considered an essential preliminary step in establishing a robust purification protocol.

How can researchers verify the structural integrity of recombinant dipZ?

Verifying structural integrity is essential after expression and purification to ensure that recombinant dipZ maintains its native conformation and function:

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content and stability

  • Surface Plasmon Resonance (SPR): Can be used to check structural integrity by measuring binding to known interaction partners

  • Functional assays: Testing the ability of purified dipZ to facilitate disulfide bond formation in suitable substrate proteins

  • Limited proteolysis: To examine domain organization and folding status

According to SPR guidelines, structural integrity assessment is a critical step before conducting detailed interaction studies. When SPR is used, abnormalities in the "dip" pattern can indicate structural issues with the immobilized protein . For membrane proteins like dipZ, additional verification using detergent-compatible methods should be considered.

How can Surface Plasmon Resonance be used to study dipZ interactions?

Surface Plasmon Resonance (SPR) is a powerful technique for studying protein-protein interactions involving dipZ:

  • Immobilization strategy: For membrane proteins like dipZ, indirect immobilization approaches are often preferred over direct coupling, as they better preserve protein activity. As noted in SPR guidelines, direct coupling often decreases or completely abrogates binding to analyte .

  • Experimental design: When studying dipZ interactions using SPR, researchers should:

    • Determine whether dipZ should be the ligand (immobilized) or analyte (in solution)

    • Consider using detergent-compatible SPR chips if dipZ is to be immobilized

    • Establish appropriate regeneration conditions that don't disrupt the immobilized protein

  • Data analysis: For reliable affinity measurements, the analyte concentration should ideally be varied over a range from 0.01× KD to 100× KD, though practically a 2-3 order of magnitude range (using 10 two-fold dilutions) is often sufficient .

The Langmuir binding model (A+L⇌AL) is typically applicable for analyzing SPR data, assuming the analyte is monovalent and homogeneous, the ligand is homogeneous, and all binding events are independent .

What advanced proteomic methods can be used to study dipZ interactome?

Deep Interactome Profiling by Mass Spectrometry (DIP-MS) represents a cutting-edge approach for comprehensive analysis of protein interaction networks:

  • Benefits for dipZ research: DIP-MS combines affinity purification to enrich the interactome of a target protein with native BNP fractionation-MS to resolve different complexes sharing the same target protein . This approach is particularly valuable for membrane proteins like dipZ, where traditional interaction studies are challenging.

  • Comparative advantages: When compared to SEC-MS or reciprocal AP-MS data, DIP-MS offers:

    • Broader dynamic range (covering approximately 4.4 logs versus 3.8 logs in SEC-MS)

    • Higher resolution capture of protein separation behavior

    • More extensive and denser interaction networks

  • Application to dipZ: This method could reveal previously unknown interaction partners of dipZ and provide insights into its role in larger protein complexes involved in redox regulation and disulfide bond formation pathways.

What methodology should be used to analyze dipZ's role in disulfide bond formation?

To investigate dipZ's role in disulfide bond formation, researchers should consider a multi-faceted approach:

  • In vivo functional assays: Monitoring the formation of disulfide bonds in periplasmic proteins in the presence and absence of functional dipZ

  • Redox state analysis: Using alkylating agents and non-reducing SDS-PAGE to trap and analyze the redox states of dipZ's conserved cysteine residues during the electron transfer process

  • Site-directed mutagenesis: Systematic mutation of the six conserved cysteine residues, individually and in pairs, to examine their specific roles in the electron transfer mechanism

  • Reconstitution experiments: Purified recombinant dipZ can be reconstituted into liposomes to study its electron transfer capability in a defined system

This methodological framework enables researchers to dissect the mechanistic details of how dipZ facilitates disulfide bond formation in the bacterial periplasm.

How should researchers design mutagenesis studies for dipZ functional analysis?

Effective mutagenesis studies of dipZ should be systematically designed to answer specific functional questions:

  • Targeting strategy:

    • Conserved cysteine residues in all three domains (as all six have been shown to contribute to function)

    • Residues in transmembrane helices that may be involved in substrate recognition

    • Regions that might participate in protein-protein interactions

  • Mutation types to consider:

    • Conservative substitutions (e.g., Cys→Ser) to maintain structural integrity while altering redox capacity

    • Non-conservative substitutions to assess structural requirements

    • Domain swapping or deletions to examine the role of specific regions

  • Functional readouts:

    • Complementation of dipZ-null strains

    • Measurement of disulfide bond formation in periplasmic proteins

    • Cytochrome c maturation assays

By combining these approaches, researchers can develop a comprehensive understanding of structure-function relationships in dipZ.

What are the common challenges in recombinant dipZ expression and how to overcome them?

Recombinant expression of membrane proteins like dipZ presents several challenges:

ChallengePossible SolutionRationale
Toxicity to host cellsUse of specialized E. coli strains (C41/C43, Lemo21)These strains are adapted for toxic membrane protein expression
Protein misfoldingLower induction temperature (16-20°C)Slower expression promotes proper folding
Low yieldOptimize media composition and induction conditionsExperimental design approach has achieved 250 mg/L for other recombinant proteins
Inclusion body formationCo-express with chaperones or use solubility-enhancing tagsAssists proper folding and membrane insertion
Improper membrane insertionUse of E. coli signal recognition particle (SRP)-dependent expression systemsEnsures proper targeting to the membrane

Additional considerations include:

  • Careful selection of detergents for extraction and purification

  • Screening multiple constructs with different tag positions

  • Using fluorescence-based fusion reporters to monitor expression and membrane localization in real-time

What controls should be included in dipZ interaction studies?

Robust interaction studies for dipZ require appropriate controls:

  • Negative controls:

    • Unrelated membrane proteins of similar size and topology

    • Mutant versions of dipZ with altered interaction sites

    • Buffer-only or detergent-only controls (particularly important in SPR studies)

  • Positive controls:

    • Known interaction partners (if available)

    • Anti-dipZ antibodies (for confirmation of proper folding)

  • Validation controls:

    • Reversal of binding partners (if dipZ is immobilized, also test with interaction partner immobilized)

    • Competition assays with unlabeled proteins

    • Concentration-dependent binding studies to establish specificity

When using SPR, researchers should verify the structural integrity of immobilized dipZ by examining the "dip" pattern before conducting interaction measurements . Additionally, for DIP-MS studies, comparing results with orthogonal methods such as proximity-dependent biotin identification can validate true interactions versus method-specific artifacts .

What are the best approaches for studying dipZ topology in membranes?

Understanding the precise membrane topology of dipZ is essential for functional studies. Several complementary approaches can be employed:

  • Gene fusion techniques:

    • PhoA (alkaline phosphatase) fusions to identify periplasmic domains

    • LacZ (β-galactosidase) fusions to identify cytoplasmic domains

    • These approaches were successfully used to determine that dipZ has eight transmembrane alpha-helices with periplasmic N-terminal and C-terminal domains

  • Cysteine accessibility methods:

    • Introduction of single cysteines followed by labeling with membrane-impermeable sulfhydryl reagents

    • Allows determination of residue exposure to either periplasmic or cytoplasmic compartments

  • Protease protection assays:

    • Limited proteolysis of spheroplasts or inverted membrane vesicles

    • Analysis of protected fragments can reveal domain organization

  • Cryo-electron microscopy:

    • For high-resolution structural analysis of dipZ in a membrane environment

    • Can provide detailed insights into transmembrane domain arrangement

Combined, these methods provide a comprehensive view of dipZ's arrangement within the bacterial membrane, which is critical for understanding its electron transfer mechanism.

How can structural biology techniques advance our understanding of dipZ?

Advanced structural biology approaches offer promising avenues for deeper insights into dipZ function:

  • Cryo-electron microscopy (cryo-EM):

    • Potential to resolve the full structure of dipZ in its membrane environment

    • May reveal conformational changes associated with electron transfer

  • X-ray crystallography of soluble domains:

    • Crystallization and structure determination of the periplasmic N-terminal and C-terminal domains

    • Would provide insights into the redox-active sites

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Can identify flexible regions and conformational changes during dipZ function

    • Particularly useful for studying membrane proteins where other structural techniques are challenging

Structural data would significantly enhance our understanding of how dipZ's transmembrane architecture enables its electron transfer function and could inform the design of inhibitors or protein engineering approaches.

What methodological approaches can address contradictions in dipZ research data?

When researchers encounter contradictory data regarding dipZ function or interactions, several methodological approaches can help resolve discrepancies:

  • Multi-technique validation:

    • Confirm findings using orthogonal methods (e.g., SPR, DIP-MS, and biochemical assays)

    • Each technique has different strengths and limitations for membrane protein analysis

  • Standardization of experimental conditions:

    • Establish consistent protein preparation protocols

    • Control detergent conditions carefully across experiments

    • Use identical buffer systems when comparing results

  • Detailed reporting of methodologies:

    • Include comprehensive descriptions of protein constructs (including tag positions)

    • Report all purification and experimental conditions in detail

    • Share raw data when possible to allow reanalysis

By applying these rigorous approaches, researchers can address contradictions and develop a more coherent understanding of dipZ structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.