Recombinant Protein elaB (elaB)

Shipped with Ice Packs
In Stock

Description

Introduction to elaB

ElaB is a C-tail-anchored inner membrane protein native to Escherichia coli, identified as a critical component in bacterial stress response mechanisms . Unlike canonical membrane proteins, elaB lacks an N-terminal signal sequence for targeting and instead uses a C-terminal transmembrane domain for anchoring to the inner membrane . Its primary role involves enhancing bacterial survival under oxidative and thermal stress, while its absence correlates with increased persister cell formation .

Table 1: Key Functional Roles of elaB

RoleMechanismOutcome
Oxidative stress resistanceNeutralizes reactive oxygen species (ROS)3.6 × 10⁴-fold survival increase vs. ΔelaB
Heat shock protectionStabilizes membrane integrity3.3 × 10⁵-fold survival increase vs. ΔelaB
Persister cell regulationPrevents dormancy12.6-fold reduction in persisters vs. ΔelaB

Regulatory Mechanisms

ElaB expression is tightly controlled by RpoS, a sigma factor active during stationary phase and stress conditions . Key regulatory insights include:

  • Transcriptional activation: RpoS binds directly to the elaB promoter, with two putative binding sites identified upstream of the start codon .

  • Growth-phase dependency: elaB transcription peaks in stationary phase and nutrient-limited environments .

Table 2: RpoS Regulation of elaB

ConditionWild-Type β-Galactosidase Activity (MU)ΔrpoS Activity (MU)Fold Change
Stationary phase1,034.2 ± 34.2268.9 ± 15.93.8-fold ↓
Overexpression (rpoS)937.6 ± 101.5117.3 ± 4.08.0-fold ↑

Experimental Validation

Survival assays under stress conditions demonstrated elaB’s protective role:

  • Heat shock (65°C, 10 min): ΔelaB survival fell to 0.0033% of wild-type levels .

  • Oxidative stress (20 mM H₂O₂, 10 min): ΔelaB viability dropped to 0.000036% of wild-type .

Table 3: Persister Cell Dynamics

TreatmentWild-Type PersistersΔelaB PersistersFold Increase
Ampicillin (100 μg/mL, 1 h)ND4.3-fold ↑
Ciprofloxacin (5 μg/mL, 1 h)ND1.15 × 10³-fold ↑

ND = Not detected .

Research Implications

  1. Stress Adaptation: ElaB’s dual role in stress resistance and persister suppression highlights its evolutionary importance in pathogenic E. coli survival strategies .

  2. Therapeutic Targets: Inhibiting elaB could enhance antibiotic efficacy by reducing persister formation, though further validation is required .

  3. Mechanistic Gaps: The precise biochemical mechanism of elaB’s stress protection remains unclear, necessitating structural and interactomic studies .

Limitations and Future Directions

While elaB’s functional significance is well-documented, no evidence exists in current literature for recombinant elaB production in heterologous systems (e.g., E. coli, yeast, mammalian cells). Further research is needed to explore:

  • Heterologous expression systems for elaB.

  • Post-translational modifications (e.g., phosphorylation) in functional regulation.

  • Potential applications in biotechnology or synthetic biology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this beforehand. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
elaB; c2810; Protein ElaB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
elaB
Target Protein Sequence
MSNQFGDTRIDDDLTLLSETLEEVLRSSGDPADQKYVELKARAEKALDDVKKRVSQASDS YYYRAKQAVYRADDYVHEKPWQGIGVGAAVGLVLGLLLARR
Uniprot No.

Target Background

Database Links

KEGG: ecc:c2810

STRING: 199310.c2810

Protein Families
ElaB/YgaM/YqjD family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ElaB protein and what is its structural classification?

ElaB is a small C-tail-anchored inner membrane protein found in Escherichia coli. It belongs to a distinctive class of membrane proteins characterized by having a C-terminal transmembrane domain but lacking an N-terminal signal sequence for membrane targeting. While proteins from this family play vital roles in eukaryotes (such as in membrane trafficking and apoptosis), their role in prokaryotes has been largely unexplored until recent studies . The protein is embedded in the inner membrane of E. coli cells with its C-terminus anchored in the membrane, giving it its classification as a "tail-anchored" protein.

What are the primary cellular functions of ElaB?

ElaB primarily functions as a stress-response protein in E. coli. Research has demonstrated that ElaB protects bacterial cells against multiple stress conditions, particularly oxidative stress and heat shock stress . Unlike some membrane peptide toxins such as TisB and GhoT, ElaB does not lead to cell death. Instead, it enhances cellular resistance to stress factors. The absence of ElaB (through gene deletion) has been shown to greatly increase persister cell formation, suggesting it plays a key role in regulating the bacterial stress response and persistence mechanisms .

How is ElaB expression regulated in bacterial cells?

ElaB expression is primarily regulated at the transcriptional level. The transcription of the elaB gene is induced during the stationary phase in E. coli . This induction is regulated by the stationary-phase sigma factor RpoS, which binds directly to the promoter region of elaB to activate its transcription. Recent studies have also indicated that the oxidative stress regulator OxyR works alongside RpoS to regulate ElaB expression specifically in response to oxidative stress conditions . This dual regulation mechanism allows bacteria to fine-tune ElaB expression according to different stress conditions they encounter.

What expression systems are most effective for recombinant ElaB production?

For recombinant ElaB production, bacterial expression systems, particularly E. coli-based systems, have proven most effective due to the protein's prokaryotic origin. Several approaches can be employed:

  • pET expression system: Using E. coli BL21(DE3) with T7 RNA polymerase control is highly efficient for ElaB expression.

  • pBAD system: Offering tight regulation through arabinose induction, useful for potentially toxic membrane proteins.

  • Cold-shock expression systems: Beneficial for membrane proteins like ElaB that might form inclusion bodies at higher temperatures.

When expressing membrane proteins like ElaB, it's critical to optimize expression conditions to prevent protein aggregation and maintain proper folding. Lower induction temperatures (16-25°C) and reduced inducer concentrations often yield better results than standard conditions .

What purification strategies yield the highest purity recombinant ElaB?

Purifying membrane proteins like ElaB requires specialized approaches:

  • Detergent solubilization: Membrane extraction using mild detergents (DDM, LDAO, or Triton X-100) is the first critical step.

  • Affinity chromatography: His-tagged ElaB can be purified using immobilized metal affinity chromatography (IMAC).

  • Size exclusion chromatography: As a polishing step to remove aggregates and achieve high purity.

For optimal results, maintain detergent concentrations above critical micelle concentration throughout purification. Using specialized chromatography resins designed for membrane proteins can significantly improve yields. Final purity should be assessed by SDS-PAGE and Western blotting, with functional integrity confirmed through activity assays specific to stress response mechanisms .

How can researchers assess the proper folding and activity of recombinant ElaB?

Assessing proper folding and activity of recombinant ElaB requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy: To evaluate secondary structure integrity

  • Membrane integration assays: To confirm proper membrane localization

  • Functional assays: Testing the protein's ability to confer oxidative stress resistance in complementation studies

  • Thermal shift assays: To assess protein stability and proper folding

  • Limited proteolysis: Correctly folded membrane proteins show characteristic proteolytic patterns

Activity assessment should involve complementation studies in elaB knockout strains, measuring survival rates under oxidative stress (e.g., hydrogen peroxide challenge) or heat shock conditions. A properly folded and active recombinant ElaB should restore stress resistance to levels comparable to wild-type cells .

How can mouse models be effectively used to evaluate recombinant ElaB's immunological properties?

Mouse models serve as valuable tools for evaluating the immunological properties of recombinant ElaB. A systematic approach involves:

  • Immunization protocol: Administer purified recombinant ElaB (typically 100 μg/100 μl) subcutaneously with an appropriate adjuvant such as Freund's complete adjuvant .

  • Control groups: Include negative controls (PBS), positive controls (inactivated bacterial strains), and comparison groups (other recombinant proteins) .

  • Immune response assessment:

    • Measure specific IgG antibody production via ELISA

    • Evaluate cytokine profiles, particularly IL-4, IL-10, and IFN-γ, to differentiate between Th1 and Th2 immune responses

    • Perform lymphocyte proliferation assays to assess cellular immunity

The experimental design should include appropriate time points for sample collection (typically days 0, 14, 28, and 42 post-immunization) and challenge studies to evaluate protective immunity. The table below outlines a typical experimental design for immunological evaluation:

GroupNo. of mice/groupAntigenDosage/volAdjuvantRoute
Negative control10PBS100 μlFreund's completeSubcutaneous
ElaB protein10Recombinant ElaB100 μg/100 μlFreund's completeSubcutaneous
Inactivated bacteria10Inactivated E. coli4.0 × 10^9 CFU/100 μlFreund's completeSubcutaneous
Combined protein group10ElaB + other protein100 μg/100 μlFreund's completeSubcutaneous

What methodologies are most effective for studying ElaB's role in oxidative stress resistance?

To investigate ElaB's role in oxidative stress resistance, several methodologies have proven particularly effective:

  • Gene knockout and complementation studies:

    • Create precise elaB deletion mutants using λ-Red recombination system

    • Complement with plasmid-expressed wild-type or mutant ElaB variants

    • Compare phenotypes under stress conditions

  • Oxidative stress challenge assays:

    • H₂O₂ sensitivity assays (typically 1-10 mM concentrations)

    • Paraquat challenge tests for superoxide stress

    • Disk diffusion assays for zone of inhibition measurements

    • Growth curve analysis under oxidative stress conditions

  • Molecular interaction studies:

    • Chromatin immunoprecipitation (ChIP) to verify RpoS and OxyR binding to the elaB promoter

    • Protein-protein interaction studies using bacterial two-hybrid systems

    • Transcriptional reporter fusions to quantify expression under various conditions

  • Microscopy-based approaches:

    • Fluorescently tagged ElaB to visualize membrane localization

    • Live/dead staining to assess cellular viability under stress

When designing these experiments, it's crucial to include appropriate controls, standardize stress conditions, and combine multiple methodologies to build a comprehensive understanding of ElaB's functional role .

How can researchers effectively measure ElaB's impact on persister cell formation?

Measuring ElaB's impact on persister cell formation requires specialized methodologies focused on this unique bacterial state:

  • Persister formation assay:

    • Grow bacterial cultures to stationary phase (where persister formation is highest)

    • Treat with bactericidal antibiotics at concentrations 10-100× MIC

    • Quantify survivors by colony forming unit (CFU) counting

    • Compare wild-type, ΔelaB mutant, and complemented strains

  • Time-kill curves:

    • Monitor bacterial killing over time (typically 0-24 hours)

    • Plot survival on logarithmic scale to visualize biphasic killing characteristic of persisters

    • Calculate persister frequencies (surviving fraction after extended antibiotic exposure)

  • Fluorescence-activated cell sorting (FACS):

    • Use persister-associated reporters or dyes (e.g., RSG or DiBAC4)

    • Sort and quantify persister subpopulations

    • Compare between strains with different elaB status

  • Single-cell microfluidics:

    • Monitor individual bacterial cells under antibiotic stress

    • Track awakening from persister state after antibiotic removal

    • Measure time-to-division distributions among different strains

When analyzing data, researchers should employ statistical methods appropriate for the highly variable nature of persister formation, typically using multiple biological replicates and logarithmic transformation of data before statistical comparison .

How does the membrane topology of ElaB influence its function in stress response?

The C-tail anchored topology of ElaB is critical to its function, with several aspects worth investigating:

  • Topology mapping: The precise orientation of ElaB in the membrane can be determined using techniques such as:

    • PhoA/LacZ fusion analysis to map membrane-spanning regions

    • Cysteine accessibility methods with membrane-impermeable reagents

    • Protease protection assays to identify exposed domains

  • Structure-function relationships: The C-terminal transmembrane domain is likely essential for proper function. Creating truncation mutants and point mutations can help identify:

    • Critical residues for membrane insertion

    • Domains responsible for stress response signaling

    • Regions involved in protein-protein interactions

  • Membrane microdomain association: ElaB may localize to specific membrane domains, which can be investigated using:

    • Membrane fractionation on sucrose gradients

    • Super-resolution microscopy with fluorescently tagged ElaB

    • Lipidomic analysis of ElaB-associated membrane regions

Understanding the topology-function relationship is crucial because disruption of C-tail-anchored inner membrane proteins reduces stress resistance and can lead to increased persistence in E. coli, suggesting a direct link between membrane positioning and cellular function .

What is the interplay between RpoS, OxyR, and other regulatory factors in controlling ElaB expression?

The complex regulatory network controlling ElaB expression involves multiple transcription factors and stress-responsive elements:

  • Transcriptional regulation mapping:

    • ChIP-seq analysis to identify all transcription factors binding the elaB promoter

    • DNase footprinting to precisely map binding sites

    • In vitro transcription assays to reconstitute regulation

  • Regulatory hierarchy determination:

    • Epistasis analysis using mutants in multiple regulatory genes

    • Time-course expression studies during stress exposure

    • Mathematical modeling of the regulatory network

  • Integration with global stress responses:

    • RNA-seq comparison of ΔrpoS, ΔoxyR, and double mutants

    • Proteomics analysis of membrane protein composition changes

    • Metabolomic profiling to identify downstream effects

Research has established that stationary-phase sigma factor RpoS regulates elaB transcription by binding to its promoter , while OxyR provides additional regulation specifically during oxidative stress . The interplay between these factors likely involves both competitive and cooperative interactions that fine-tune elaB expression according to specific stress conditions and growth phases.

How does ElaB mechanistically protect against oxidative stress at the molecular level?

The molecular mechanisms underlying ElaB's protective effect against oxidative stress remain incompletely understood, providing rich ground for advanced research:

  • Direct antioxidant properties assessment:

    • Reactive oxygen species (ROS) scavenging assays with purified ElaB

    • Electron paramagnetic resonance (EPR) spectroscopy to detect radical interactions

    • Identification of oxidizable residues by mass spectrometry

  • Membrane integrity effects:

    • Membrane permeability measurements under oxidative stress

    • Lipid peroxidation quantification in wild-type vs. ΔelaB strains

    • Artificial membrane systems with reconstituted ElaB

  • Interactome analysis:

    • Pull-down assays to identify ElaB-interacting proteins

    • Crosslinking mass spectrometry to map interaction interfaces

    • BioID or APEX2 proximity labeling to identify nearby proteins in vivo

  • Signaling pathway identification:

    • Phosphoproteomic analysis to identify altered signaling cascades

    • Genetic screening for suppressors of the ΔelaB oxidative stress sensitivity

    • Transcriptomic profiling to identify downstream effectors

Understanding these mechanisms will provide insights not only into bacterial stress responses but also into the evolutionarily conserved roles of tail-anchored membrane proteins across domains of life .

What are the common challenges in recombinant ElaB expression and how can they be overcome?

Researchers frequently encounter several challenges when working with recombinant ElaB:

  • Inclusion body formation:

    • Problem: Overexpression often leads to inclusion bodies

    • Solutions:

      • Reduce expression temperature to 16-20°C

      • Use solubility-enhancing fusion tags (MBP, SUMO, Trx)

      • Optimize inducer concentration (typically using 0.1-0.5 mM IPTG instead of 1 mM)

      • Consider codon-optimized constructs

  • Membrane integration issues:

    • Problem: Improper membrane localization affects functionality

    • Solutions:

      • Ensure intact C-terminal transmembrane domain

      • Co-express with chaperones (GroEL/ES, DnaK/J)

      • Use E. coli strains optimized for membrane protein expression (C41/C43)

      • Consider mild detergent addition during induction

  • Protein instability:

    • Problem: Rapid degradation after expression

    • Solutions:

      • Add protease inhibitors during purification

      • Optimize buffer conditions (pH 7.0-8.0, 150-300 mM NaCl)

      • Include stabilizing agents (glycerol 5-10%, reducing agents)

      • Consider fusion with stability-enhancing partners

  • Low yield:

    • Problem: Insufficient protein for experiments

    • Solutions:

      • Scale up culture volume

      • Optimize cell density at induction (OD600 0.6-0.8)

      • Use rich media formulations (TB, 2xYT)

      • Consider auto-induction media for higher biomass

When troubleshooting, systematic optimization of each parameter is recommended, keeping detailed records of conditions and results to identify optimal expression parameters .

How can researchers distinguish between direct and indirect effects of ElaB in stress response studies?

Distinguishing direct from indirect effects of ElaB requires sophisticated experimental designs:

  • In vitro reconstitution:

    • Purify ElaB and incorporate into liposomes or nanodiscs

    • Test direct effects on membrane properties under oxidative stress

    • Compare with control proteins having similar topology

  • Point mutation analysis:

    • Create a library of ElaB point mutants

    • Identify mutations that specifically affect stress response

    • Map these to functional domains or interaction surfaces

  • Rapid induction systems:

    • Use inducible promoters with tight control for time-course studies

    • Monitor immediate responses (seconds to minutes) vs. longer-term adaptations

    • Employ riboswitch or optogenetic tools for precise temporal control

  • Multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics

    • Identify direct targets through early response analysis

    • Build network models distinguishing primary from secondary effects

  • Genetic interaction mapping:

    • Perform synthetic genetic array analysis with elaB deletion

    • Identify epistatic relationships with other stress response genes

    • Use double-mutant analysis to place ElaB in known pathways

This comprehensive approach helps build a mechanistic understanding of ElaB's role, separating its direct molecular functions from downstream cellular adaptations .

What considerations are important when designing ElaB knockout and complementation experiments?

Designing robust ElaB knockout and complementation experiments requires attention to several critical factors:

  • Knockout strategy selection:

    • Clean deletion vs. insertional inactivation

    • Consideration of polar effects on downstream genes

    • Marker selection (antibiotic resistance vs. markerless)

    • Genome editing technique choice (λ-Red, CRISPR-Cas9)

  • Complementation design:

    • Expression level control (native promoter vs. inducible)

    • Copy number considerations (chromosomal integration vs. plasmid)

    • Inclusion of native regulatory elements

    • Epitope tagging strategies that preserve function

  • Validation approaches:

    • RT-qPCR to confirm absence of transcript

    • Western blotting to verify protein absence

    • Phenotypic characterization under multiple conditions

    • Whole genome sequencing to identify potential suppressors

  • Controls inclusion:

    • Empty vector controls for complementation

    • Wild-type strain with same antibiotic markers

    • Complementation with known non-functional mutants

    • Heterologous complementation with orthologs from related species

  • Experimental design considerations:

    • Growth phase standardization (stationary phase is critical for ElaB)

    • Stress condition optimization (type, intensity, duration)

    • Technical and biological replication strategy

    • Statistical approach for data analysis

Properly designed knockout and complementation studies are essential for attributing phenotypes specifically to ElaB function rather than to secondary genetic effects or compensatory adaptations .

What potential applications exist for ElaB in synthetic biology and biotechnology?

ElaB's unique properties as a stress-responsive membrane protein open several promising applications:

  • Biosensor development:

    • Engineer ElaB-based reporters for oxidative stress detection

    • Develop whole-cell biosensors using ElaB promoter fusions

    • Create synthetic stress response circuits incorporating ElaB components

  • Biocontainment strategies:

    • Utilize ElaB's role in persistence to design controlled bacterial death switches

    • Develop stress-responsive kill switches for synthetic organisms

    • Create environmental sensing-survival circuits for targeted applications

  • Bioproduction enhancement:

    • Overexpress or engineer ElaB to improve bacterial survival in industrial fermentation

    • Reduce stress-induced growth arrest in bioproduction strains

    • Enhance tolerance to toxic metabolites in chemical-producing bacteria

  • Antimicrobial development:

    • Target ElaB function to sensitize bacteria to oxidative stress

    • Develop anti-persister strategies based on ElaB inhibition

    • Design combination therapies targeting stress response pathways

These applications would require further characterization of ElaB's structure-function relationships and development of tools to precisely control its expression and activity in engineered biological systems .

How might comparative genomics and evolutionary studies of ElaB orthologs inform our understanding of bacterial stress responses?

Comparative genomics and evolutionary analyses of ElaB provide valuable insights into bacterial stress adaptation:

  • Ortholog identification and analysis:

    • Survey ElaB orthologs across bacterial phyla

    • Compare sequence conservation patterns to identify functional domains

    • Map evolutionary pressures through Ka/Ks ratio analysis

    • Identify co-evolved gene clusters suggesting functional relationships

  • Structural comparisons:

    • Model structures of diverse ElaB orthologs

    • Identify conserved structural features despite sequence divergence

    • Analyze transmembrane domain conservation across species

  • Horizontal gene transfer assessment:

    • Evaluate phylogenetic incongruence suggesting HGT events

    • Identify genomic islands or mobile elements associated with elaB

    • Compare GC content and codon usage patterns

  • Host-pathogen adaptation studies:

    • Compare ElaB variants between free-living and host-associated bacteria

    • Analyze selection pressures in host-adapted lineages

    • Identify potential host-specific adaptations in the stress response system

This evolutionary perspective can reveal the fundamental importance of tail-anchored membrane proteins in bacterial adaptation and provide insights into the diversification of stress response mechanisms across bacterial lineages .

What novel methodologies could advance our understanding of ElaB's role in bacterial persistence?

Emerging technologies offer exciting opportunities to deepen our understanding of ElaB's role in persistence:

  • Single-cell technologies:

    • Time-lapse microfluidics combined with fluorescent reporters

    • Single-cell RNA-seq to capture transcriptional heterogeneity

    • Mass cytometry for high-dimensional persister cell characterization

    • Raman microscopy for label-free metabolic profiling of individual cells

  • High-resolution imaging approaches:

    • Cryo-electron tomography of ElaB in native membranes

    • Super-resolution microscopy to track ElaB localization during stress

    • Correlative light and electron microscopy to link localization with ultrastructure

  • Systems biology integration:

    • Multi-omics data integration using machine learning approaches

    • Flux balance analysis incorporating ElaB-dependent constraints

    • Genome-scale models of persistence incorporating ElaB functions

  • CRISPR-based technologies:

    • CRISPRi screens to identify genetic interactions with elaB

    • Base editing to create point mutation libraries

    • CRISPR activation systems for controlled expression modulation

  • In vivo approaches:

    • Development of animal models to study ElaB's role in pathogen persistence

    • Host-pathogen interaction studies focusing on stress responses

    • Evolution experiments to identify adaptive mutations affecting ElaB function

These methodologies, alone or in combination, will help resolve the complex mechanisms by which ElaB influences bacterial persistence and stress adaptation, potentially leading to new therapeutic strategies against persistent bacterial infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.