Recombinant Staphylococcus aureus Protein flp (flp)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Molecular Features

FeatureDetails
UniProt IDQ8NUZ4 (strain MW2) , Q6G6M9 , Q9KJ74
Expression systemEscherichia coli (with N-terminal His tag)
Protein sequence homologyFmtA-like protein; lacks penicillin-binding activity
Purity>90% (SDS-PAGE)

Recombinant Expression and Purification

Recombinant flp is produced in E. coli systems, typically fused with a His tag for purification . Key specifications include:

  • Storage: Lyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week .

Functional and Mechanistic Insights

  • Methicillin resistance: Inactivation of flp in methicillin-resistant S. aureus (MRSA) strains did not alter resistance levels, suggesting a non-essential role in this phenotype .

  • Cell wall association: Structural homology to PBPs implies potential involvement in peptidoglycan synthesis, though enzymatic activity remains unconfirmed .

  • Adhesion/invasion: While not directly studied for flp, related S. aureus proteins (e.g., FnBP, ClfA) mediate host-cell adhesion . flp’s role in virulence is unexplored.

Research Applications and Limitations

  • Antigen potential: flp has not been tested in vaccine studies, unlike other S. aureus antigens (e.g., FnBP, ClfA) .

  • Biochemical studies: Recombinant flp is used to probe cell wall synthesis mechanisms, given its PBP-like motifs .

  • Knowledge gaps: No direct evidence links flp to virulence or antibiotic resistance modulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly specify your preference when placing the order and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. We recommend reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles to maintain optimal protein integrity.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag, please inform us and we will prioritize development of the specified tag.
Synonyms
flp; Protein flp; FmtA-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-498
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
flp
Target Protein Sequence
MTTKKLYFLSISIIILVAISIAIYITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGAS ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDA VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDSVTSKNNRLNDVTHAIMGDEL HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNYKSKHDA IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK LVEHLNTQIVNHKRYSTVASMLNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL LRRSKRIAVLSWLSLCICIALALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL FSTLIVILLFLHTKITKT
Uniprot No.

Target Background

Function
The precise function of this protein is currently unknown. It lacks penicillin-binding activity and is not implicated in methicillin resistance.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Staphylococcus aureus Protein flp and what is its significance in research?

Staphylococcus aureus Protein flp (flp) is a 498-amino acid protein also known as "FmtA-like protein." It is encoded by the flp gene found in various S. aureus strains. While the complete function of flp in S. aureus biology remains under investigation, its significance derives from its potential role in S. aureus pathogenicity and its conservation across clinical isolates.

The protein is part of S. aureus biology, a gram-positive bacterium that can exist as both a commensal organism (commonly found in the upper respiratory tract and skin) and an opportunistic pathogen capable of causing a range of infections from minor skin conditions to life-threatening diseases such as pneumonia, meningitis, osteomyelitis, endocarditis, toxic shock syndrome, bacteremia, and sepsis .

Research on recombinant flp protein contributes to our understanding of S. aureus pathogenesis and potential vaccine development strategies, particularly as S. aureus infections remain a significant public health concern.

How should researchers optimally express recombinant Staphylococcus aureus Protein flp?

For optimal expression of recombinant flp protein, researchers should consider the following methodological approach:

Expression Systems:

The most commonly used expression system is E. coli, which has been successfully employed to produce functional recombinant flp protein with suitable yields for research purposes . Alternative expression systems include yeast, baculovirus, or mammalian cell systems, which may offer advantages for specific experimental requirements .

Expression Constructs:

For efficient purification, the flp gene is typically cloned with an N-terminal or C-terminal affinity tag. His-tagged constructs are most common and allow for efficient purification using nickel affinity chromatography . The full-length construct (amino acids 1-498) is typically used, though specific applications may benefit from expressing defined regions of the protein.

Expression Protocol:

  • Transform the expression construct into an appropriate E. coli strain (e.g., BL21(DE3))

  • Culture in suitable media (LB or enriched media for higher yields)

  • Induce protein expression at mid-log phase using an appropriate inducer (IPTG for T7-based systems)

  • Optimize temperature and duration of induction (typically 16-20°C for 16-20 hours yields better soluble protein)

  • Harvest cells by centrifugation and proceed with cell lysis and protein purification

Following expression, purification typically involves affinity chromatography, with subsequent optional steps including ion exchange and size exclusion chromatography to achieve higher purity if required for specific applications.

What are the optimal storage and handling conditions for recombinant flp protein?

To maintain protein stability and activity, researchers should adhere to the following storage and handling recommendations:

Short-term Storage:

  • Store working aliquots at 4°C for up to one week

  • Use appropriate buffer conditions (typically Tris-based buffer, pH 8.0)

Long-term Storage:

  • Store at -20°C/-80°C

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Add glycerol (typically 50% final concentration) as a cryoprotectant

Reconstitution of Lyophilized Protein:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration) for long-term storage

Handling Precautions:

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

  • When thawing frozen aliquots, thaw on ice to minimize protein degradation

  • Handle the protein using low-protein-binding tubes and pipette tips to minimize loss

Following these guidelines will help ensure experimental reproducibility and maintain the integrity of the recombinant protein for research applications.

How does flp protein contribute to Staphylococcus aureus pathogenicity?

While the specific contribution of flp protein to S. aureus pathogenicity is still being fully elucidated, several aspects of its potential role can be inferred from current research:

Potential Functions:

  • Cell Surface Interaction: As an FmtA-like protein, flp may be involved in cell wall integrity or peptidoglycan structure, potentially affecting bacterial surface properties and host-pathogen interactions .

  • Biofilm Formation: S. aureus pathogenicity is significantly enhanced by its ability to form biofilms - microbially derived sessile communities attached to a substratum, interface, or each other, embedded in an extracellular polymeric matrix . Surface proteins contribute to biofilm formation, and flp may play a role in this process, although this requires further investigation.

  • Immune Evasion: Like other S. aureus surface proteins, flp might contribute to immune evasion strategies, potentially through interactions with host immune components.

Research Methodology to Investigate flp's Role:

To further characterize flp's contribution to pathogenicity, researchers could employ the following approaches:

  • Gene Knockout Studies: Creating flp deletion mutants and assessing virulence in appropriate infection models

  • Protein Interaction Studies: Identifying host or bacterial interaction partners of flp

  • Immunization Studies: Testing whether antibodies against flp can provide protection against S. aureus infection

  • Structural Analysis: Determining the three-dimensional structure of flp to provide insights into its function

Understanding flp's role in S. aureus pathogenicity could potentially inform new therapeutic strategies against this important pathogen.

What methodologies can be employed to study the immunogenicity of flp protein?

Investigating the immunogenicity of flp protein is a promising area of research, particularly for vaccine development. Several methodological approaches can be employed:

Animal Immunization Studies:

  • Immunize mice or other model organisms with purified recombinant flp protein (typically 40-80 μg) using appropriate adjuvants

  • Collect serum samples and analyze antibody titers using ELISA

  • Challenge immunized animals with live S. aureus to assess protection

  • Compare survival rates between immunized and control groups

Epitope Mapping:

  • Generate monoclonal antibodies against flp protein using hybridoma technology

  • Identify protective vs. non-protective epitopes using approaches such as:

    • Peptide arrays

    • Alanine scanning mutagenesis

    • Competitive binding assays

  • Test epitope-specific antibodies for protective efficacy in animal models

Human Antibody Response Analysis:

  • Screen serum samples from healthy individuals and S. aureus-infected patients

  • Assess natural antibody responses against flp protein

  • Correlate antibody levels with protection against infection

Structure-Function Relationship Studies:

  • Determine the three-dimensional structure of flp

  • Identify surface-exposed regions that might serve as antibody targets

  • Engineer variants with modified immunogenic properties

The above methodologies can provide valuable insights into flp's potential as a vaccine candidate against S. aureus infections. Similar approaches have been successfully employed for other S. aureus proteins such as CgoX and TPI, which have shown promise in protective immunity studies .

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to confirm proper secondary structure folding

  • Size exclusion chromatography to ensure the protein is not aggregated

  • Thermal shift assays to assess protein stability

Binding Studies:

  • Investigate potential binding partners using pull-down assays

  • Surface plasmon resonance (SPR) to measure binding kinetics to potential ligands

  • Protein-lipid interaction studies if membrane association is suspected

Functional Assays:

  • Test for enzymatic activity if an enzymatic function is suspected

  • Assess impact on bacterial cell wall integrity in complementation studies with mutant strains

  • Evaluate effects on biofilm formation when added exogenously or when overexpressed

Immunological Activity:

  • Verify antibody recognition using sera from patients with S. aureus infections

  • Test the ability of flp-specific antibodies to recognize native protein on the bacterial surface

  • Assess opsonophagocytic activity of anti-flp antibodies

Cell Culture Studies:

  • Evaluate effects on host cell interaction and invasion

  • Test for immunomodulatory properties on immune cells

  • Assess cytotoxicity potential

Since the specific function of flp remains under investigation, a comprehensive approach combining multiple methods would provide the most reliable assessment of recombinant protein functionality.

How does flp protein compare across different Staphylococcus aureus strains?

Understanding the conservation and variation of flp protein across different S. aureus strains is crucial for research applications, particularly for its potential as a vaccine candidate. Based on the available information:

Sequence Conservation:

The flp protein shows high sequence conservation across many S. aureus strains, though minor variations exist. Comparing the sequences from different reference strains:

StrainUniProt IDNotable Sequence FeaturesAmino Acid Length
NCTC 8325Q2FVH6Reference sequence498 aa
Strain N315Q7A3Q5Few amino acid substitutions compared to NCTC 8325498 aa
Strain COLVariousSimilar to reference sequence498 aa

Methodology for Strain Comparison Studies:

To systematically analyze flp across S. aureus strains, researchers should consider:

  • Genomic Analysis:

    • PCR amplification and sequencing of the flp gene from clinical isolates

    • Whole-genome sequencing data mining for comprehensive strain comparisons

    • Phylogenetic analysis to trace evolutionary relationships

  • Expression Analysis:

    • Comparative transcriptomics to assess flp expression levels under different conditions

    • Western blot analysis to compare protein levels across strains

    • Immunofluorescence microscopy to evaluate surface localization

  • Functional Comparison:

    • Cross-reactivity testing of antibodies against flp from different strains

    • Comparative virulence studies using isogenic mutants across strain backgrounds

The high conservation of flp across clinical S. aureus isolates suggests it may serve an important function in bacterial physiology and potentially represents a valuable target for broad-spectrum therapeutic approaches.

What role does flp protein potentially play in biofilm formation?

Biofilms are a key virulence factor for S. aureus, contributing to antibiotic resistance and immune evasion. While the specific role of flp protein in biofilm formation is not fully characterized in the provided search results, we can outline a methodological approach to investigate this potential relationship:

Hypothesized Roles in Biofilm Formation:

  • Initial Attachment: As a surface protein, flp might mediate attachment to biotic or abiotic surfaces

  • Intercellular Adhesion: Flp could potentially participate in cell-to-cell interactions within the biofilm

  • Biofilm Matrix Component: The protein might contribute to the extracellular polymeric substance (EPS) that forms the biofilm matrix

  • Regulatory Role: Flp could influence the expression of other biofilm-associated genes

Experimental Approaches to Investigate flp's Role in Biofilms:

  • Genetic Manipulation Studies:

    • Generate flp deletion mutants and assess biofilm formation capacity

    • Create flp overexpression strains to determine effects on biofilm development

    • Perform complementation studies to confirm phenotypes

  • Microscopy Analysis:

    • Use confocal laser scanning microscopy to visualize biofilm architecture in wild-type vs. flp mutants

    • Employ immunofluorescence microscopy with anti-flp antibodies to localize the protein within biofilms

    • Apply electron microscopy to assess ultrastructural differences

  • Biochemical Characterization:

    • Extract and analyze biofilm matrix components from wild-type vs. flp mutants

    • Evaluate the interaction of purified flp with known biofilm matrix components

    • Assess effects of recombinant flp on preformed biofilms

  • Antibody Intervention Studies:

    • Test whether anti-flp antibodies can prevent biofilm formation or disrupt established biofilms

    • Evaluate antibody penetration into S. aureus biofilms using labeled antibodies

Understanding flp's potential role in biofilm formation could provide valuable insights for developing targeted anti-biofilm strategies against S. aureus infections .

How can recombinant flp protein be utilized in vaccine development against Staphylococcus aureus?

Developing effective vaccines against S. aureus remains a significant challenge in infectious disease research. Recombinant flp protein offers potential as a vaccine candidate, and researchers can explore this possibility through the following methodological approaches:

Immunogenicity Assessment:

  • Evaluate the ability of recombinant flp to elicit specific antibody responses in animal models

  • Determine optimal immunization protocols, including:

    • Protein dose (typically 40-80 μg per immunization)

    • Adjuvant selection

    • Immunization schedule (primary plus booster immunizations)

  • Measure antibody titers using ELISA and assess functional activity through opsonophagocytic assays

Protective Efficacy Studies:

  • Challenge immunized animals with virulent S. aureus strains

  • Evaluate protection using metrics such as:

    • Survival rates

    • Bacterial burden in organs

    • Disease severity scores

  • Compare full-length flp protein with specific protective epitopes

Epitope-Focused Vaccine Design:

  • Identify protective epitopes within flp using monoclonal antibodies

  • Develop epitope-conjugate vaccines using carrier proteins (e.g., BSA)

  • Evaluate whether focused epitope vaccines provide equivalent or superior protection compared to full-length protein

Combination Vaccine Approaches:

  • Test flp in combination with other S. aureus antigens for synergistic protection

  • Potential combination partners include CgoX and TPI, which have shown promise in protective immunity studies

  • Evaluate different delivery platforms (e.g., protein subunit, DNA vaccines, viral vectors)

Immune Response Characterization:

  • Analyze both humoral and cellular immune responses to flp immunization

  • Determine correlates of protection

  • Evaluate cross-protection against diverse clinical S. aureus isolates

This systematic approach can help determine whether flp represents a viable vaccine candidate against S. aureus infections, either alone or as part of a multi-component vaccine formulation.

What strategies can researchers employ to improve the solubility and yield of recombinant flp protein?

Producing high-quality recombinant flp protein with good solubility and yield can be challenging. Researchers can employ several strategies to optimize production:

Expression Optimization:

  • Expression System Selection:

    • E. coli remains the most common system for recombinant flp expression

    • Alternative systems to consider for improved solubility include:

      • Yeast (Pichia pastoris or Saccharomyces cerevisiae)

      • Baculovirus-infected insect cells

      • Mammalian expression systems for complex proteins

  • Expression Construct Design:

    • Test different affinity tags (His6, GST, MBP, SUMO) to identify optimal solubility

    • Position tags at either N- or C-terminus to determine effect on solubility

    • Include TEV or other protease cleavage sites for tag removal if needed

    • Consider expressing soluble domains if full-length protein proves challenging

  • E. coli Strain Selection:

    • BL21(DE3) and derivatives for standard expression

    • Origami or SHuffle strains for proteins requiring disulfide bonds

    • Arctic Express or other cold-adapted strains for expression at lower temperatures

    • Rosetta strains for proteins with rare codons

Expression Conditions:

  • Culture Parameters:

    • Optimize growth media (LB, TB, 2xYT, minimal media with supplements)

    • Test different induction points (typically mid-log phase, OD600 0.6-0.8)

    • Vary inducer concentration (0.1-1.0 mM IPTG for T7 systems)

    • Evaluate different post-induction temperatures (16°C, 25°C, 30°C, 37°C)

    • Adjust induction duration (4h to overnight)

  • Solubility Enhancement:

    • Add solubility enhancers to culture media (sorbitol, glycerol, ethanol)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J/GrpE)

    • Include mild detergents in lysis buffers for membrane-associated regions

Purification Optimization:

  • Buffer Optimization:

    • Screen different pH conditions (typically pH 7.0-8.5)

    • Test various salt concentrations (100-500 mM NaCl)

    • Include stabilizing agents (glycerol, arginine, trehalose)

    • Add reducing agents if needed (DTT, β-mercaptoethanol, TCEP)

  • Purification Strategy:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged protein)

    • Intermediate polish using ion exchange chromatography

    • Final polishing with size exclusion chromatography

    • Consider on-column refolding for inclusion body purification

By systematically optimizing these parameters, researchers can significantly improve the solubility and yield of recombinant flp protein for their specific experimental needs.

How can researchers design monoclonal antibodies against flp protein for detection and functional studies?

Developing monoclonal antibodies (mAbs) against flp protein provides valuable tools for detection, localization, and functional studies. Here's a methodological approach for researchers:

Immunization Strategy:

  • Use purified recombinant flp protein as the immunogen

  • Implement a robust immunization protocol:

    • Primary immunization with complete Freund's adjuvant (80 μg protein)

    • Boost immunizations with incomplete Freund's adjuvant (40-50 μg protein)

    • Allow sufficient time between immunizations (typically 3-4 weeks)

  • Monitor antibody response by ELISA before proceeding to hybridoma generation

Hybridoma Development:

  • Harvest splenocytes from immunized mice showing strong antibody responses

  • Fuse with myeloma cells using polyethylene glycol (PEG)

  • Plate in HAT selection medium and allow hybridomas to establish

  • Screen supernatants for flp-specific antibodies using ELISA

Screening and Selection Strategy:

  • Primary screen: ELISA against recombinant flp protein

  • Secondary screens to identify functionally relevant mAbs:

    • Binding to native flp on S. aureus surface by flow cytometry

    • Recognition of different S. aureus strains to assess cross-reactivity

    • Functional assays such as bacterial opsonization or biofilm inhibition

  • Select hybridomas with desired characteristics for cloning and expansion

Antibody Characterization:

  • Determine antibody isotype and subclass

  • Map epitopes using techniques such as:

    • Peptide arrays

    • Hydrogen-deuterium exchange mass spectrometry

    • Alanine scanning mutagenesis

  • Assess binding kinetics using surface plasmon resonance

  • Evaluate cross-reactivity with human proteins to ensure specificity

Functional Evaluation of mAbs:

  • Test protective efficacy in animal infection models (200-300 μg per mouse)

  • Group antibodies by epitope recognition and functional properties

  • Evaluate ability to recognize flp in both planktonic and biofilm states

  • Assess potential for diagnostic applications

This systematic approach has been successfully employed for other S. aureus antigens and can yield valuable mAbs for both research and potential therapeutic applications related to flp protein .

What are the key experimental considerations when studying interactions between flp protein and the host immune system?

Understanding how flp protein interacts with the host immune system is crucial for developing effective vaccines and immunotherapeutics. Researchers should consider these methodological approaches:

Neutrophil Interaction Assays:

  • Neutrophil binding and activation

  • Respiratory burst measurement

  • Neutrophil extracellular trap (NET) formation

  • Opsonophagocytic killing assays with anti-flp antibodies

Macrophage Response Analysis:

  • Phagocytosis assays with labeled flp protein

  • Cytokine production measurement (TNF-α, IL-1β, IL-6)

  • Assessment of inflammasome activation

  • Analysis of antigen presentation

T-cell Response:

  • T-cell epitope mapping

  • Proliferation assays with flp-stimulated T-cells

  • Cytokine profiling (IFN-γ, IL-17, IL-4)

  • Characterization of T-cell subsets involved in response

B-cell Response:

  • B-cell epitope mapping

  • Analysis of antibody isotype distribution

  • Affinity maturation assessment

  • Memory B-cell characterization

Epitope Analysis Methods:

  • Epitope mapping techniques:

    • Peptide array screening

    • Hydrogen-deuterium exchange mass spectrometry

    • X-ray crystallography of antibody-antigen complexes

  • Classify epitopes as protective, non-protective, or potentially disease-enhancing

  • Develop epitope-focused vaccine candidates based on protective epitopes

Animal Model Considerations:

  • Select appropriate animal models for S. aureus infection

  • Consider route of infection relevant to human disease

  • Include different challenge strains to assess cross-protection

  • Evaluate both active immunization and passive antibody transfer

Human Sample Studies:

  • Compare antibody responses in:

    • Healthy carriers

    • Acute infection cases

    • Chronic/recurrent infection patients

  • Characterize natural anti-flp antibody repertoires

  • Correlate antibody titers with clinical outcomes

These methodological approaches will help elucidate how flp protein interacts with the immune system and whether targeting this protein could provide protective immunity against S. aureus infections.

How does flp protein compare to other Staphylococcus aureus surface proteins as research and therapeutic targets?

Comparing flp protein to other well-characterized S. aureus surface proteins provides context for its potential as a research and therapeutic target:

Comparative Analysis Framework:

Propertyflp ProteinProtein A (SpA)Wall Teichoic Acid (WTA)Other Surface Proteins
Conservation across strainsHighly conserved sequence Variability in repeat regionsConserved structure with variable glycosylationVariable conservation
ImmunogenicityUnder investigationHigh; binds immunoglobulins at Fc region Recognized by protective mAbs (4461, 4497) Variable
Role in pathogenesisPotential roles being investigatedImmune evasion, inflammation, inhibits osteogenesis Important for colonization and biofilm formation Various virulence functions
Vaccine potentialBeing investigatedLimited due to Fc bindingPromising target for passive immunization CgoX and TPI show protection in mouse models

Methodological Considerations for Comparative Studies:

  • Structural Comparison:

    • Analyze domain organization and functional motifs

    • Compare surface accessibility of potential epitopes

    • Evaluate post-translational modifications

  • Expression Profile Analysis:

    • Compare expression levels under different growth conditions

    • Analyze temporal expression during infection

    • Evaluate expression in biofilm vs. planktonic states

  • Functional Redundancy Assessment:

    • Investigate potential functional overlap with other proteins

    • Create multiple knockout strains to identify compensatory mechanisms

    • Test combination therapies targeting multiple surface proteins

  • Comparative Immunization Studies:

    • Evaluate protective efficacy of individual proteins

    • Test combination vaccines for synergistic protection

    • Compare antibody functionality against different target proteins

  • Therapeutic Accessibility:

    • Assess antibody binding to targets in various growth states

    • Compare penetration into biofilms

    • Evaluate potential for resistance development

These comparative analyses can help position flp protein within the broader context of S. aureus surface proteins and inform its potential utility as a research and therapeutic target.

What advanced analytical techniques are most informative for characterizing recombinant flp protein structure and function?

To thoroughly characterize recombinant flp protein structure and function, researchers should employ a range of advanced analytical techniques:

Structural Analysis Techniques:

  • X-ray Crystallography:

    • Provides atomic-level resolution of protein structure

    • Requires successful crystallization of purified flp protein

    • May reveal functional domains and potential binding sites

    • Can be challenging for membrane-associated proteins

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Enables solution structure determination

    • Provides insights into protein dynamics

    • Can identify regions involved in binding interactions

    • May be limited by protein size (flp at 498 aa may require domain-by-domain analysis)

  • Cryo-Electron Microscopy (Cryo-EM):

    • Allows visualization of protein structure without crystallization

    • Particularly useful for larger protein complexes

    • Can capture different conformational states

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps solvent-accessible regions and conformational changes

    • Identifies dynamic regions and potential binding sites

    • Useful for epitope mapping of antibody binding sites

Functional Characterization Techniques:

  • Surface Plasmon Resonance (SPR):

    • Measures real-time binding kinetics with potential interaction partners

    • Determines association/dissociation rates and binding affinities

    • Can screen multiple potential binding partners efficiently

  • Isothermal Titration Calorimetry (ITC):

    • Provides thermodynamic parameters of binding interactions

    • Determines binding stoichiometry, affinity, and enthalpy changes

    • Requires no protein modification or immobilization

  • Microscale Thermophoresis (MST):

    • Detects interactions based on changes in thermophoretic mobility

    • Requires minimal protein amounts

    • Works in near-native conditions

  • Protein-Lipid Interaction Analysis:

    • Liposome binding assays

    • Monolayer insertion measurements

    • Particularly relevant if flp has membrane-associated functions

Advanced Cellular and Imaging Techniques:

  • Super-Resolution Microscopy:

    • Visualizes flp localization on bacterial surface with nanometer precision

    • Techniques such as STORM, PALM, or STED provide resolution beyond diffraction limit

    • Can track dynamic processes in living cells

  • Single-Molecule Tracking:

    • Follows individual protein molecules in real-time

    • Reveals heterogeneity in behavior not apparent in bulk measurements

    • Can identify transient interactions

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines fluorescence localization with ultrastructural context

    • Particularly useful for understanding flp's location in bacterial architecture

Integrating data from these complementary techniques will provide a comprehensive understanding of flp protein structure and function, informing its potential applications in research and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.