Recombinant Vibrio parahaemolyticus serotype O3:K6 Protein HflK (hflK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
hflK; VP2815; Protein HflK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-400
Protein Length
full length protein
Species
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Target Names
hflK
Target Protein Sequence
MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFNKLSQKLGGKFGKKGG GGSSIGGGGGAIGFGVIAIIAIAVWIFAGFYTIGEAERGVVLRLGKYDRIVDPGLNWRPR FIDEYEAVNVQAIRSLRASGLMLTKDENVVTVAMDVQYRVADPYKYLYRVTNADDSLRQA TDSALRAVIGDSLMDSILTSGRQQIRQSTQETLNQIIDSYDMGLVIVDVNFQSARPPEQV KDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERVTNEALGQVAQ FEKLLPEYQAAPGVTRDRLYIDAMEEVYTNTSKVLIDSESSGNLLYLPIDKLAGQEGQTD TKRKSKSSSTYDHIQLESERTQEETSNTQSRSTGTRQGRY
Uniprot No.

Target Background

Function
HflC and HflK may encode or regulate a protease.
Database Links

KEGG: vpa:VP2815

STRING: 223926.VP2815

Protein Families
Band 7/mec-2 family, HflK subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What are the recommended expression systems and conditions for recombinant HflK production?

    Expression of recombinant Vibrio parahaemolyticus HflK has been successfully achieved in E. coli expression systems . The methodological approach typically includes:

    • Cloning the hflK gene into an expression vector with an N-terminal His-tag

    • Transforming the construct into E. coli expression strains

    • Inducing expression under optimal conditions (temperature, IPTG concentration)

    • Purifying using affinity chromatography

    For effective PCR amplification of the hflK gene, the following primers have been utilized:

    • Forward primer (hflK-F): 5'-CGGAATTCATGGCGTGGAATCAGCCC-3'

    • Reverse primer (hflK-R): 5'-CCCAAGCTTTTATTGCTCTTGTCATCCACCAG-3'

    The recombinant protein is typically stored as a lyophilized powder and can be reconstituted in Tris/PBS-based buffer with 6% Trehalose (pH 8.0) to a concentration of 0.1-1.0 mg/mL .

  • How does the HflK protein integrate into membrane protein complexes?

    HflK functions as part of a membrane protein complex with FtsH (a AAA protease) and HflC. This megadalton complex spans the inner membrane and extends into the periplasm of the bacterial cell . Recent structural studies have revealed that HflK/C forms an asymmetric nautilus-like assembly with an entryway for membrane-embedded substrates to reach and be engaged by FtsH . This architecture is critical for:

    • Creating a controlled access point for substrate proteins

    • Facilitating the extraction of membrane-embedded substrates

    • Regulating the proteolytic activity of FtsH

    The membrane curvature in FtsH- HflK/C complexes is opposite that of surrounding membrane regions, a property that correlates with lipid-scramblase activity and possibly with FtsH's function in the degradation of membrane-embedded proteins .

  • What methods are available for analyzing the purity and functionality of recombinant HflK?

    Several analytical methods can be employed to assess recombinant HflK quality:

    • SDS-PAGE: For purity assessment, with expected purity greater than 90%

    • Circular Dichroism: To verify proper secondary structure folding

    • Size Exclusion Chromatography: To analyze oligomeric state

    • Mass Spectrometry: For precise molecular weight determination and post-translational modification analysis

    • Functional Assays: Including:

      • Complex formation assays with FtsH and HflC proteins

      • Membrane association studies

      • Protease regulation assays

    The recombinant protein can be stored at -20°C/-80°C upon receipt, with aliquoting recommended for multiple uses. Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

Advanced Research Questions

  • How does the FtsH-HflK-HflC complex architecture influence proteolytic substrate recognition?

    Recent cryo-EM structural studies have revealed two contrasting models for the FtsH-HflK-HflC complex:

    1. Symmetric model: Previous studies of overproduced protein components showed symmetric HflK/C cages surrounding FtsH in a manner proposed to inhibit degradation of membrane-embedded substrates.

    2. Asymmetric model: More recent structures of native complexes demonstrate that HflK/C instead forms an asymmetric nautilus-like assembly with an entryway for membrane-embedded substrates to reach and be engaged by FtsH .

    The nautilus-like structure appears to enhance FtsH degradation of certain membrane-embedded substrates, as supported by proteomic assays . This structure creates specialized microenvironments that:

    • Enable selective substrate recruitment

    • Facilitate membrane protein extraction from the lipid bilayer

    • Control the rate and specificity of proteolytic degradation

    These findings suggest that HflK/C doesn't simply inhibit FtsH activity but rather regulates substrate selectivity and accessibility in a more complex manner than previously understood .

  • What cross-linking mass spectrometry (XL-MS) approaches are effective for analyzing the HflK interaction network?

    Cross-linking mass spectrometry (XL-MS) has proven valuable for elucidating the protein interactions of HflK within protein complexes. A comprehensive XL-MS workflow includes:

    1. Cross-linking: Using reagents like DSBU to capture protein-protein interactions

    2. Digestion: Typically using trypsin to generate peptide fragments

    3. MS Analysis: High-resolution mass spectrometry to identify cross-linked peptides

    4. Data Processing: Using specialized XL-MS software tools:

      • XlinkX

      • MS Annika

      • MeroX

      • MaxLynx

    In a comparative study of the FtsH-HflK-HflC complex, researchers identified:

    • 106 interactions involving HflC

    • 96 interactions involving FtsH

    • 23 interactions involving HflK

    Approximately 93% of these interactions were found in purified complex samples. Manual verification of the interactions through raw MS and MS/MS data confirmed 223 out of 225 interactions, providing high confidence in the results .

  • What is the role of HflK in the virulence and pathogenicity mechanisms of Vibrio parahaemolyticus?

    While HflK is not among the primary virulence factors of Vibrio parahaemolyticus (such as TDH, TRH, T3SS, and T6SS), it plays important regulatory roles that may indirectly influence pathogenicity:

    • As part of the FtsH-HflK-HflC complex, it contributes to protein quality control that may affect virulence factor production and stability

    • Membrane protein degradation regulation may influence cell surface properties important for host interaction

    • Potential role in stress response adaptation that facilitates survival in host environments

    The major known virulence factors of V. parahaemolyticus include:

    Virulence FactorFunctionReference
    TDH (Thermostable Direct Hemolysin)Hemolytic and enterotoxin activity
    TRH (TDH-Related Hemolysin)Shares 54.8-68.8% sequence identity with TDH
    T3SS1 (Type 3 Secretion System 1)Biofilm formation, movement, cytotoxicity
    T3SS2 (Type 3 Secretion System 2)Negative regulation of cellular inflammatory response
    T6SS1 (Type 6 Secretion System 1)Environmental adaptability
    T6SS2 (Type 6 Secretion System 2)Adhesion to host cells
    VpadFNovel adhesive factor contributing to virulence

    Understanding how HflK interacts with these known virulence mechanisms requires further research.

  • How can recombinant HflK be utilized for developing vaccines against Vibrio parahaemolyticus?

    Research on recombinant HflK has demonstrated promising immunogenic properties that could be leveraged for vaccine development. When tested as a recombinant protein-based vaccine, rHflK has shown the ability to:

    1. Induce significant levels of both Th1 and Th2 cytokines (p<0.05)

    2. Upregulate TNF-α mRNA expression (ratio = 2.26)

    3. Significantly upregulate IL-10 mRNA expression (ratio = 3.34)

    4. Upregulate IL-4 mRNA expression (ratio = 2.63)

    5. Increase IL-12p40 mRNA expression (ratio = 1.64)

    6. Upregulate IFN-γ mRNA expression (ratio = 2.22)

    These immunological responses suggest recombinant HflK could serve as an effective vaccine antigen. The methodology for vaccine preparation typically involves:

    • Expression and purification of recombinant HflK

    • Formulation with appropriate adjuvants

    • Immunization protocols with prime and boost strategies

    • Challenge experiments to assess protective efficacy

    The balanced induction of both Th1 and Th2 responses is particularly promising for developing effective protection against V. parahaemolyticus infection .

  • What are the current challenges in structural analysis of the FtsH-HflK-HflC membrane protein complex?

    Structural analysis of the FtsH-HflK-HflC complex faces several technical challenges:

    1. Membrane Protein Extraction: Maintaining native structure during solubilization

    2. Complex Heterogeneity: Different conformational states complicate analysis

    3. Resolution Limitations: Particularly for dynamic regions of the complex

    4. Detergent Interference: Can affect structural integrity and analysis

    Recent successful approaches have employed:

    • Detergent-Based Extraction: Using DDM for solubilization

    • Polymer-Based Extraction: Using Carboxy-DIBMA

    • Advanced Cryo-EM Processing:

      • Signal subtraction

      • Local refinement strategies

      • Class averaging and selection

    For model building, researchers have used a combination of:

    • ChimeraX-1.3 (Pettersen et al., 2021)

    • Coot (0.9.4) (Casanal et al., 2020)

    • Phenix (1.14) (Liebschner et al., 2019)

    These approaches have enabled the resolution of asymmetric nautilus-like assemblies that provide new insights into complex function.

  • How does the genetic diversity of Vibrio parahaemolyticus serotype O3:K6 affect the structure and function of the HflK protein?

    Vibrio parahaemolyticus serotype O3:K6 emerged as a pandemic clone in 1996, with subsequent global spread and evolution of serovariants . This genetic diversity raises important questions about HflK variation:

    • Sequence Conservation: The degree of hflK gene conservation across different O3:K6 isolates and its serovariants (O3:K68, O3:K58, OUT:K6)

    • Structural Implications: How sequence variations might affect HflK protein structure and complex formation

    • Functional Consequences: Potential impact on regulatory functions and virulence

    Research methodologies to address these questions include:

    1. Comparative Genomics: Analysis of hflK sequences across multiple isolates

    2. Structure-Function Studies: Using site-directed mutagenesis to assess the impact of natural variations

    3. Population Genetics: Analyzing selection pressures on the hflK gene

    The pandemic O3:K6 serotype and its serovariants have spread throughout Asia, America, Africa, and Europe , making this research particularly relevant for global public health.

Research Methodology Considerations

  • What are the optimal storage and handling conditions for maintaining recombinant HflK stability?

    For optimal stability and activity of recombinant Vibrio parahaemolyticus HflK protein:

    • Initial Storage: Store at -20°C/-80°C upon receipt

    • Aliquoting: Necessary for multiple use to avoid repeated freeze-thaw cycles

    • Reconstitution: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Glycerol Addition: Add 5-50% glycerol (final concentration) for long-term storage

    • Working Aliquots: Store at 4°C for up to one week

    • Buffer Composition: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

    Before opening, briefly centrifuge the vial to bring contents to the bottom. After reconstitution, the default final concentration of glycerol recommended is 50% .

  • How can cross-species conservation of HflK be leveraged for comparative functional studies?

    The HflK protein structure and function have been studied across multiple bacterial species, enabling comparative approaches that can provide deeper insights:

    1. Sequence Alignment Analysis: Comparing HflK from V. parahaemolyticus with homologs from other species to identify conserved domains and species-specific features

    2. Heterologous Expression Systems: Testing complementation of hflK mutations across species

    3. Structural Modeling: Using known structures from well-characterized species (e.g., E. coli) to predict V. parahaemolyticus HflK structure and function

    4. Functional Conservation: Evaluating whether regulatory roles in membrane protein quality control are conserved

    5. Chimeric Protein Analysis: Creating fusion proteins with domains from different species to map functional regions

    The FtsH-HflK-HflC complex appears to be widely conserved across bacterial species, suggesting fundamental roles in bacterial physiology that extend beyond species-specific functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.