Recombinant Protein hupE (hupE)

Shipped with Ice Packs
In Stock

Description

Definition and Gene Information

Recombinant Protein hupE is a bioengineered version of the hupE gene product from Rhizobium leguminosarum bv. viciae. This protein is expressed in E. coli with a His-tag for facilitated purification and characterization.

Gene/Protein AttributeDetails
Gene NamehupE
OrganismRhizobium leguminosarum bv. viciae
UniProt IDP27650
Protein Length22–191 amino acids (mature protein)
TagN-terminal His-tag
Expression HostE. coli

Expression and Purification

hupE is produced via recombinant DNA technology, leveraging E. coli as the host organism. Key steps include:

  • Cloning: Insertion of the hupE gene into an expression vector.

  • Fermentation: Growth of E. coli under optimized conditions to maximize protein yield.

  • Purification: Affinity chromatography (e.g., IMAC) for His-tagged protein isolation.

ParameterSpecification
Purity>90% (SDS-PAGE)
Concentration0.1–1.0 mg/mL (reconstituted)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)

Applications in Research and Industry

Recombinant hupE serves as a tool for:

ApplicationDetails
SDS-PAGE AnalysisUsed to validate protein integrity and purity.
Antibody ProductionServes as an antigen for generating specific antibodies.
Protein Interaction StudiesInvestigates binding partners via co-IP or pull-down assays.

Research Gaps and Future Directions

Current literature lacks detailed functional studies on hupE. Priorities include:

  1. Mechanistic Insights: Elucidating its role in Rhizobium metabolism or symbiosis.

  2. Structural Analysis: X-ray crystallography or NMR to map interaction domains.

  3. Therapeutic Potential: Exploring biotechnological applications in agriculture or bioremediation.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for custom preparation.
Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag type is required, please inform us for preferential development.
Synonyms
hupE; Protein HupE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-191
Protein Length
Full Length of Mature Protein
Species
Rhizobium leguminosarum bv. viciae
Target Names
hupE
Target Protein Sequence
HVGLHADGTLAGLNHPFSGLDHILAMVAVGFWASTLGGKAVWIVPSAFVIVMAGGGVLGI EGIALPMVETAIALTVAMLGLLVAFEVKIPTPVAAIVVGICALFHGHVHGIELPTMSNAT GYVAGFLAATVILHVLGIGLASLRFGKAGQVVARVAGGAVALAGAALLVG
Uniprot No.

Target Background

Function

Essential for full hydrogenase activity.

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of hupE protein in bacterial systems?

HupE functions primarily as a nickel transporter in Rhizobium leguminosarum, playing a crucial role in the hydrogen uptake (Hup) system. The protein is encoded within an 18-gene cluster (hupSLCDEFGHIJK-hypABFCDEX) essential for hydrogen metabolism . Functionally, HupE facilitates the uptake of nickel ions, which are required as cofactors for the maturation and activity of the nickel-containing hydrogenase enzyme. This has been demonstrated through complementation studies where expression of hupE in Escherichia coli nikABCDE mutant strain HYD723 restored both hydrogenase activity and nickel transport capabilities .

The significance of HupE extends beyond simple metal transport, as it represents a distinct class of nickel permeases that differs structurally from the well-characterized NiCoT family transporters such as HoxN from Ralstonia eutropha, HupN from Bradyrhizobium japonicum, and NixA from Helicobacter pylori . This suggests a potentially unique mechanism of nickel transport that may be shared with homologous proteins like UreJ found in urease gene clusters.

How can recombinant hupE protein be expressed and purified for functional studies?

The expression and purification of recombinant hupE protein requires careful consideration of its membrane-bound nature. Based on established protocols for similar membrane proteins, a recommended methodology includes:

  • Vector Selection and Construct Design:

    • Clone the hupE gene into an expression vector containing appropriate affinity tags (His6 or SUMO fusion tags)

    • Consider using vectors similar to pET28a-based systems that have been successful for membrane protein expression

  • Expression System:

    • Transform the construct into E. coli expression strains specialized for membrane proteins (C41(DE3) or C43(DE3))

    • Grow cultures in rich media such as 2xYT at 37°C until appropriate density

    • Induce protein expression at lower temperatures (18-20°C) with reduced IPTG concentrations (0.1-0.5 mM) to minimize inclusion body formation

  • Membrane Extraction and Purification:

    • Harvest cells and disrupt by sonication or mechanical lysis

    • Separate membrane fractions by ultracentrifugation

    • Solubilize membranes using detergents compatible with membrane protein stability (DDM, LDAO, or OG)

    • Purify using affinity chromatography followed by size exclusion chromatography

This approach has been effective for the expression and purification of transmembrane proteins with similar structural characteristics to hupE .

What are the key structural features of hupE that contribute to its nickel transport function?

HupE contains several key structural features that are essential for its nickel transport activity:

  • Transmembrane Domains:
    The protein contains six putative transmembrane domains that anchor it within the cell membrane, creating a channel for nickel translocation .

  • Critical Motifs:
    Site-directed mutagenesis experiments have identified two essential motifs in HupE:

    • HX₅DH motif: A histidine-rich sequence that likely participates in coordinating nickel ions

    • FHGX[AV]HGXE motif: Another conserved sequence containing histidine residues that are required for functionality

  • Signal Peptide:
    HupE possesses a predicted signal peptide that facilitates proper localization to the membrane .

These structural elements collectively enable the selective transport of nickel ions across the membrane, distinguishing HupE from other metal transporters. Mutation of histidine residues within these conserved motifs significantly reduces or abolishes the nickel transport capability of HupE, indicating their direct involvement in the mechanism of metal transport .

How do experimental approaches for studying hupE differ from those used for other membrane transporters?

Studying hupE presents unique methodological challenges compared to other membrane transporters due to its distinct structural characteristics and functional properties:

  • Functional Assays:

    • Unlike proton-coupled transporters that can be studied with pH-sensitive dyes, hupE function is typically assessed indirectly through:

      • Complementation of nickel transport-deficient mutants

      • Measurement of hydrogenase activity as a proxy for successful nickel transport

      • ⁶³Ni uptake assays to directly quantify transport efficiency

  • Structural Analysis:

    • Standard crystallography approaches have limited success with hupE due to its membrane-embedded nature

    • Alternative approaches include:

      • Cross-linking studies to identify proximity relationships between transmembrane domains

      • Site-directed spin labeling combined with EPR spectroscopy to map conformational changes

      • Cryo-EM for structural determination without crystallization

  • Genetic and Phenotypic Analysis:

    • Creation of in-frame deletions rather than insertional mutations to avoid polar effects on downstream genes in the hup cluster

    • Complementation studies using controlled expression systems (e.g., pBAD18-Kan vector)

    • Assessment in multiple genetic backgrounds to distinguish hupE-specific effects from strain-dependent phenotypes

  • Comparative Analysis with hupE2:

    • Parallel investigation of hupE and hupE2 provides insight into functional redundancy and specialization

    • Construction of single and double mutants to assess the relative contribution of each transporter

These methodological considerations are essential for accurate characterization of hupE function and must be tailored to the specific research questions being addressed.

What experimental design strategies are most effective for evaluating hupE expression under different environmental conditions?

Effective experimental design for studying hupE expression under varying environmental conditions requires a comprehensive approach that addresses both technical and biological variability:

  • Factorial Experimental Design:

    • Implement multi-factor designs that simultaneously evaluate the effect of:

      • Nickel concentration

      • Oxygen tension

      • pH

      • Carbon source

      • Growth phase

    • This approach enables identification of interaction effects between factors that might be missed in one-factor-at-a-time designs

  • Time-Course Analyses:

    • Monitor expression dynamics across growth phases rather than single time-point measurements

    • Implement sampling windows to capture critical transition periods

  • Reporter Systems:

    • Construct transcriptional and translational fusions (hupE::lacZ, hupE::gfp) to quantitatively assess expression

    • Include appropriate controls with constitutive promoters to normalize for cellular state

  • Quantitative Expression Analysis:

    MethodAdvantagesLimitationsAppropriate Use Case
    qRT-PCRHigh sensitivity, quantitativeRNA extraction biasLow abundance transcripts
    RNA-SeqGenome-wide context, splice variantsCost, complex analysisGlobal expression patterns
    Western BlotProtein-level confirmationAntibody specificityVerification of translation
    Flow CytometrySingle-cell resolutionRequires fluorescent tagPopulation heterogeneity
  • Statistical Considerations:

    • Implement power analysis to determine appropriate biological and technical replication

    • Consider retrospective designed sampling approaches for high-dimensional datasets

    • Apply appropriate statistical models to account for time-series autocorrelation

This comprehensive approach ensures robust data collection and interpretation, enabling the identification of environmental conditions that significantly impact hupE expression and activity.

How can systems biology approaches be applied to understand the regulatory networks governing hupE expression?

Systems biology offers powerful tools to elucidate the complex regulatory networks governing hupE expression in Rhizobium leguminosarum:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data to create a comprehensive view of the cellular state

    • Use correlation networks to identify co-regulated genes and metabolites associated with hupE expression

    • Implement data integration strategies such as:

      • Multi-block principal component analysis

      • Canonical correlation analysis

      • Bayesian network inference

  • Network Reconstruction:

    • Develop genome-scale metabolic models that incorporate nickel transport and hydrogenase activity

    • Identify regulatory motifs in promoter regions of hupE and co-regulated genes

    • Perform ChIP-seq experiments to identify transcription factors binding to the hupE promoter

    • Use network topology analysis to identify key regulatory hubs

  • Perturbation Experiments:

    • Apply the principles of experimental design for big data analysis :

      • Systematically perturb the system through genetic modifications and environmental changes

      • Implement retrospective designed sampling to optimize information gain while minimizing experimental effort

      • Utilize Bayesian experimental design approaches to maximize expected utility of experiments

  • Computational Modeling:

    • Develop ordinary differential equation models of nickel homeostasis

    • Implement stochastic simulations to capture cell-to-cell variability in expression

    • Create agent-based models to understand spatial aspects of membrane protein distribution

  • Validation Strategies:

    • Test model predictions through targeted gene knockouts

    • Implement CRISPR interference for temporal control of gene expression

    • Perform targeted metabolite supplementation experiments

This systems-level approach provides a framework for understanding how hupE expression is coordinated with other cellular processes and responds to changing environmental conditions, offering insights beyond what can be achieved through reductionist approaches.

What are the most reliable methods for assessing the interaction between hupE and other components of the nickel transport system?

Reliable assessment of interactions between hupE and other components of the nickel transport system requires a combination of in vivo and in vitro approaches:

  • Genetic Interaction Analysis:

    • Systematic construction of double mutants to identify synthetic lethality or suppression

    • Epistasis analysis to establish genetic hierarchies

    • Complementation studies with chimeric proteins to identify functional domains

  • Protein-Protein Interaction Methods:

    TechniqueStrengthsLimitationsApplication to hupE
    Bacterial Two-HybridIn vivo, allows membrane proteinsPotential false positivesScreen for binary interactions
    Co-immunoprecipitationCaptures native complexesRequires antibodies or tagsIdentify stable interactors
    Cross-linking Mass SpectrometryCaptures transient interactionsComplex analysisMap interaction interfaces
    FRET/BRETReal-time in vivo dynamicsRequires fluorescent tagsMonitor interaction kinetics
    Surface Plasmon ResonanceQuantitative binding parametersRequires purified componentsDetermine affinity constants
  • Functional Reconstitution:

    • Incorporate purified hupE into proteoliposomes

    • Measure nickel transport in the presence of purified components of the transport system

    • Assess the impact of mutations on complex formation and activity

  • Structural Analysis of Complexes:

    • Single-particle cryo-EM to visualize transport complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Integrated structural biology combining multiple data types

  • In situ Visualization:

    • Fluorescence colocalization microscopy to track spatial arrangement

    • Single-molecule tracking to monitor dynamic associations

    • Super-resolution techniques to resolve nanoscale organization

By combining these complementary approaches, researchers can build a comprehensive understanding of how hupE interacts with other components of the nickel transport system, providing insights into the molecular mechanisms underlying transport efficiency and regulation.

What are the best practices for designing site-directed mutagenesis experiments to probe the function of conserved motifs in hupE?

Effective site-directed mutagenesis strategies for investigating conserved motifs in hupE require careful planning and systematic execution:

  • Motif Identification and Prioritization:

    • Perform comprehensive sequence alignment across diverse bacterial species

    • Focus on the critical HX₅DH and FHGX[AV]HGXE motifs previously identified

    • Utilize conservation scoring to prioritize residues for mutagenesis

  • Mutation Strategy Design:

    Mutation TypePurposeExample in hupE Context
    Alanine ScanningRemove side chain functionHis→Ala in HX₅DH motif
    Conservative SubstitutionsMaintain chemical propertiesHis→Asn to remove metal coordination
    Charge ReversalsDisrupt electrostatic interactionsAsp→Lys in conserved motifs
    Domain SwappingTest functional exchangeabilityReplace motifs with those from hupE2
    Insertion/DeletionProbe spatial requirementsAlter spacing in HX₅DH motif
  • Technical Considerations:

    • Utilize overlap extension PCR or commercial site-directed mutagenesis kits

    • Design primers with appropriate melting temperatures and minimal secondary structure

    • Confirm mutations by sequencing the entire coding region to verify the absence of unwanted changes

    • Consider codon optimization for the expression system being used

  • Functional Assessment:

    • Implement a tiered approach to phenotypic characterization:

      • Primary screen: Complementation of nickel transport in appropriate mutant backgrounds

      • Secondary validation: Direct measurement of nickel uptake rates

      • Tertiary analysis: Structural integrity assessment through techniques like circular dichroism

    • Quantify relative activities compared to wild-type protein

    • Determine kinetic parameters to distinguish effects on affinity versus transport rate

  • Data Interpretation Framework:

    • Establish clear criteria for categorizing mutant phenotypes:

      • No effect: ≥90% of wild-type activity

      • Partial effect: 10-90% of wild-type activity

      • Severe effect: <10% of wild-type activity

    • Correlate functional defects with structural predictions

    • Consider potential long-range effects on protein conformation

This systematic approach to site-directed mutagenesis provides a robust framework for dissecting the functional significance of conserved motifs in hupE, enabling the development of detailed structure-function relationships.

How does hupE differ functionally and structurally from other nickel transporters like NiCoT family proteins?

The functional and structural differences between hupE and NiCoT family transporters reflect distinct evolutionary solutions to nickel transport:

  • Sequence and Structural Divergence:

    • HupE lacks significant sequence similarity with NiCoT family transporters such as HoxN, HupN, and NixA

    • While NiCoT transporters typically contain 8 transmembrane domains, hupE contains 6 predicted transmembrane segments

    • HupE contains unique conserved motifs (HX₅DH and FHGX[AV]HGXE) not found in NiCoT transporters

  • Transport Mechanism Differences:

    CharacteristicHupENiCoT Transporters
    Energy CouplingNot fully characterizedProton-driven secondary transport
    Ion SelectivityNickel-specificCan transport cobalt and nickel
    Transport KineticsVariable depending on conditionsGenerally high-affinity transport
    Regulatory ElementsIntegrated with hydrogen uptake genesOften independently regulated
  • Functional Context:

    • HupE is encoded within the hydrogen uptake gene cluster, suggesting coordinated expression with hydrogenase components

    • NiCoT transporters are often standalone genes or associated with diverse nickel-utilizing enzymes

    • HupE functionality appears to be complemented by HupE2 in R. leguminosarum, providing redundancy

  • Species Distribution:

    • HupE/UreJ-like transporters are frequently found in rhizobia and other soil bacteria

    • NiCoT transporters have a broader distribution across bacterial phyla

    • Co-occurrence analysis suggests different ecological niches and functional associations

  • Experimental Approaches for Differentiation:

    • Heterologous expression studies in appropriate mutant backgrounds

    • Competitive inhibition assays to determine substrate specificity

    • Membrane topology mapping to confirm structural differences

Understanding these differences provides critical insights into the evolution of metal transport systems and informs strategies for manipulating nickel homeostasis in various bacterial systems.

What insights can be gained from comparing the biochemical properties of hupE and hupE2 from Rhizobium leguminosarum?

Comparative analysis of hupE and hupE2 provides valuable insights into functional specialization and redundancy within the nickel transport system:

  • Sequence Homology and Divergence:

    • HupE2 shows 48% amino acid sequence identity with HupE, indicating a likely gene duplication event

    • Critical motifs are conserved between both proteins, suggesting shared mechanistic features

    • Regions of sequence divergence may indicate adaptation to different cellular contexts or regulatory control

  • Functional Complementarity:

    • Both HupE and HupE2 can restore hydrogenase activity when expressed in E. coli nikABCDE mutant strain HYD723

    • Nickel transport assays reveal different levels of nickel uptake, suggesting quantitative functional differences

    • The double mutant (hupE hupE2) exhibits reduced hydrogenase activity compared to single mutants, indicating partial functional redundancy

  • Differential Expression and Regulation:

    • Unlike hupE, which is part of the hydrogenase gene cluster, hupE2 is a hydrogenase-unlinked gene

    • This genomic organization suggests different regulatory controls and potential involvement in distinct cellular processes

    • Expression analysis may reveal condition-specific activation of each transporter

  • Host-Specific Functionality:

    • The double mutant shows low levels of symbiotic hydrogenase activity in lentil bacteroids but not in pea bacteroids

    • This host-dependent phenotype suggests specialized roles in different symbiotic interactions

    • Comparative analysis across host plants can identify factors that influence transporter preference

  • Evolutionary Implications:

    • The maintenance of two similar but distinct nickel transporters suggests selective advantage

    • Comparative genomics across Rhizobium species can reveal patterns of conservation or specialization

    • Analysis of selection pressures on each gene can identify regions under adaptive evolution

This comparative approach not only enhances our understanding of nickel transport in Rhizobium but also provides a framework for investigating functional diversification following gene duplication events.

What are the major technical challenges in expressing and purifying functional recombinant hupE, and how can they be overcome?

The expression and purification of functional recombinant hupE presents several technical challenges inherent to membrane proteins, each requiring specific strategies:

  • Toxicity and Growth Inhibition:

    • Challenge: Overexpression of membrane proteins often causes toxicity to host cells

    • Solutions:

      • Use tightly regulated expression systems (e.g., pBAD, pET with lac repression)

      • Lower induction temperatures (16-20°C) and reduced inducer concentrations

      • Consider specialized expression strains like C41(DE3) designed for toxic membrane proteins

      • Implement auto-induction media for gradual protein expression

  • Protein Misfolding and Aggregation:

    • Challenge: Membrane proteins tend to aggregate when overexpressed

    • Solutions:

      • Express as fusion proteins with solubility enhancers (SUMO, MBP, Trx)

      • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

      • Add specific lipids or detergents to the growth medium

      • Consider cell-free expression systems with supplied lipids or nanodiscs

  • Extraction and Solubilization:

    DetergentAdvantagesLimitationsRecommended Use
    DDMMild, maintains activityExpensive, large micellesInitial extraction
    LDAOSmaller micelles, good for crystallizationPotentially denaturingPurification steps
    DigitoninVery mild, preserves complexesExpensive, heterogeneousComplex stability studies
    SMA CopolymerExtracts native lipid environmentLimited compatibility with techniquesNative state analysis
  • Purification Efficiency:

    • Challenge: Low yields and purity often complicate membrane protein studies

    • Solutions:

      • Implement two-step affinity purification (e.g., His-tag followed by second affinity tag)

      • Use size exclusion chromatography to separate monomeric protein from aggregates

      • Consider on-column detergent exchange during purification

      • Optimize buffer conditions (pH, salt, glycerol) for stability

  • Functional Assessment:

    • Challenge: Confirming that purified hupE retains native conformation and activity

    • Solutions:

      • Develop in vitro transport assays using proteoliposomes

      • Implement thermal shift assays to assess protein stability

      • Use circular dichroism to confirm secondary structure content

      • Consider native mass spectrometry to verify oligomeric state

By systematically addressing these challenges, researchers can significantly improve the likelihood of obtaining functional recombinant hupE suitable for detailed biochemical and structural characterization.

How can researchers optimize experimental conditions for measuring nickel transport activity of recombinant hupE?

Optimizing experimental conditions for measuring nickel transport activity requires careful consideration of multiple parameters:

  • Selection of Appropriate Assay Systems:

    Assay TypePrincipleAdvantagesLimitations
    Radioisotope UptakeDirect measurement using ⁶³NiQuantitative, high sensitivityRequires radioactive materials
    Fluorescent ProbesNi²⁺-sensitive fluorophoresReal-time measurements, non-radioactivePotential interference, indirect
    ICP-MSElemental analysis of Ni contentHigh sensitivity, multi-elementDestructive, endpoint measurement
    Hydrogenase ActivityIndirect measurement of Ni uptakeFunctional readoutNot specific to transport step
  • Reconstitution System Optimization:

    • Liposome Composition:

      • Test different lipid compositions (e.g., POPC, POPE, bacterial lipid extracts)

      • Optimize protein:lipid ratios (typically 1:100 to 1:1000 w/w)

      • Consider incorporating native lipids from R. leguminosarum

    • Reconstitution Method:

      • Compare detergent dialysis, direct dilution, and extrusion methods

      • Verify incorporation efficiency using density gradient centrifugation

      • Confirm orientation using protease protection assays

  • Buffer and Reaction Conditions:

    • pH Optimization:

      • Test range from pH 5.5-8.0 to identify optimal transport conditions

      • Consider pH gradient effects on transport directionality

    • Ion Composition:

      • Evaluate effects of K⁺, Na⁺, and divalent cations on transport

      • Test potential counter-ions or co-transported species

    • Temperature Effects:

      • Determine temperature optimum (typically 25-37°C)

      • Assess temperature stability of the reconstituted system

  • Kinetic Parameter Determination:

    • Initial Rate Measurements:

      • Use early time points to determine initial velocity

      • Implement rapid filtration or quenched-flow techniques

    • Concentration Dependence:

      • Test wide Ni²⁺ concentration range (nM to μM)

      • Account for non-specific binding to liposomes

    • Inhibitor Studies:

      • Assess competition with other divalent metals

      • Test effect of protonophores and ionophores

  • Data Analysis and Validation:

    • Apply appropriate kinetic models (Michaelis-Menten, Hill equation)

    • Implement global fitting for complex transport mechanisms

    • Validate with site-directed mutants of key residues in the HX₅DH and FHGX[AV]HGXE motifs

These optimized conditions provide a robust framework for quantitative assessment of hupE-mediated nickel transport, enabling detailed mechanistic studies and comparison with other nickel transport systems.

What emerging technologies and approaches could advance our understanding of hupE structure and function?

Several cutting-edge technologies and approaches hold promise for elucidating the structural and functional aspects of hupE:

  • Advanced Structural Biology Techniques:

    • Cryo-Electron Microscopy:

      • Single-particle analysis for high-resolution structure determination

      • Tomography for visualizing hupE in its native membrane environment

    • Integrative Structural Biology:

      • Combining data from multiple techniques (X-ray crystallography, NMR, SAXS)

      • Computational modeling to bridge resolution gaps

    • Serial Crystallography:

      • X-ray free-electron laser (XFEL) studies of microcrystals

      • Time-resolved studies to capture transport intermediates

  • Innovative Functional Characterization Methods:

    • Single-Molecule Techniques:

      • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

      • Electrical recordings of single transporters in lipid bilayers

    • Advanced Imaging:

      • Super-resolution microscopy to track hupE localization and dynamics

      • Correlative light and electron microscopy for contextual structural information

    • Microfluidic Approaches:

      • Gradient generation systems to study transport under defined conditions

      • Single-cell analysis of transport activity and expression

  • Genetic and Genomic Innovations:

    • CRISPR-Cas Technologies:

      • Precise genome editing to create targeted mutations

      • CRISPRi for titratable repression of hupE expression

      • Base editing for introducing specific amino acid changes

    • Comparative Genomics:

      • Analysis across diverse bacterial species to identify conserved features

      • Evolutionary studies to trace the diversification of nickel transport systems

    • Functional Metagenomics:

      • Discovery of novel hupE variants from environmental samples

      • Identification of context-dependent adaptations

  • Computational and Systems Approaches:

    • Molecular Dynamics Simulations:

      • All-atom simulations of hupE in membrane environments

      • Enhanced sampling methods to study rare transport events

    • Machine Learning Applications:

      • Prediction of functionally important residues

      • Classification of structural states from experimental data

    • Network Analysis:

      • Integration of hupE function into cellular metabolic networks

      • Prediction of condition-specific roles and interactions

These emerging technologies and approaches, especially when applied in combination, have the potential to significantly advance our understanding of hupE structure, function, and integration into cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.