Recombinant Protein jagunal homolog (K05C4.2)

What is the structure and cellular localization of jagunal homolog proteins?

Jagunal homolog proteins, including C. elegans K05C4.2 and human JAGN1, are relatively small (<200 amino acids) transmembrane proteins characterized by a tetraspanning topology with:

• Four transmembrane domains

• Two extracellular/luminal loops

• Both NH2- and COOH-termini facing the cytoplasm

These proteins localize primarily to the endoplasmic reticulum (ER) under steady state conditions . The C. elegans K05C4.2 protein sequence (189 amino acids) begins with MSSRGVRAAGTDGTDFQNRQRVAQHYQESAQYKSILKWFFVPHFLILVFMWLKVGSELLR and contains highly conserved N- and C-terminal regions that likely represent important functional domains .

What are the evolutionary conservation patterns of jagunal homolog proteins?

Jagunal homolog proteins show remarkable conservation across diverse species:

• First identified in Drosophila melanogaster

• Present throughout animal and plant phylogeny

• Highly conserved in model organisms including mouse (Mus musculus), fruit fly (D. melanogaster), frog (X. laevis), zebrafish (D. rerio), and nematode (C. elegans)

The N- and C-termini are especially highly conserved among species, suggesting they represent critical functional regions, possibly serving as interfaces for interactions with other proteins . This high degree of conservation across diverse organisms indicates that jagunal homologs support fundamental cellular processes not restricted to specific tissues or developmental stages.

What biological functions are associated with jagunal homolog proteins?

Jagunal homolog proteins are involved in:

• Vesicle-mediated transport between cellular compartments

• ER reorganization during Drosophila oocyte development

• Neutrophil differentiation and survival

• Protein glycosylation, particularly affecting fucosylation and sialylation

• B cell function and antibody production

• Proinsulin biosynthesis regulation

In C. elegans, K05C4.2 is part of an operon (CEOP1752), which also includes the sol-2 (K05C4.11) gene , suggesting potential coordinated expression with other genes.

What molecular mechanisms underlie JAGN1's role in protein trafficking?

JAGN1 contains sorting motifs that suggest a role in bidirectional ER-Golgi trafficking:

• Anterograde (ER-to-Golgi) transport:

  • JAGN1 contains dihydrophobic and diacidic motifs in its C-terminus that may link it to COPII-coating machinery

  • Likely facilitates sorting of specific client proteins into ER-derived COPII vesicles destined for the Golgi

• Retrograde (Golgi-to-ER) transport:

  • The C-terminal -KKHK sequence of JAGN1 fits the consensus dilysine motif recognized by COPI recycling machinery

  • Interactions between JAGN1 and COPI subunits have been detected

  • May facilitate recycling of glycosyltransferases, particularly fucosyltransferase and sialyltransferase that lack COPI-binding motifs

JAGN1 shares key characteristics with two families of known cargo transporters: tetraspanins and endoplasmic reticulum vesicle (Erv) proteins, including the same membrane topology, high conservation across species, selective protein trafficking, and contains sorting motifs for interaction with coating machineries .

How do mutations in JAGN1 lead to severe congenital neutropenia?

Mutations in JAGN1 lead to severe congenital neutropenia (SCN) through multiple mechanisms:

• Disrupted protein glycosylation:

  • JAGN1 deficiency affects fucosylation and sialylation

  • Glycosylation defects occur on proteins essential for neutrophil function, including integrins, collagenase, lactoferrin, and neutrophilic granule proteins

• Impaired GCSF receptor signaling:

  • JAGN1 deficiency interferes with STAT3 phosphorylation upon GCSF treatment

  • This disrupts a key pathway for neutrophil differentiation and survival

• ER stress-induced apoptosis:

  • Mutations in JAGN1 cause ER stress and intracellular calcium activation of calpain

  • This leads to myeloid cell apoptosis

• Reduced myeloperoxidase expression:

  • JAGN1 deficiency decreases MPO expression in neutrophils

  • This contributes to ineffective killing of pathogens like Candida albicans

Interestingly, granulocyte-macrophage colony-stimulating factor (GM-CSF) treatment can partially restore neutrophil function in JAGN1-deficient cells .

What experimental approaches are most effective for studying recombinant jagunal homolog proteins?

For effective study of recombinant jagunal homolog proteins, researchers should consider:

• Expression systems:

  • E. coli has been used successfully for recombinant expression of C. elegans K05C4.2 with His-tag

  • For mammalian JAGN1, plasmacytoma cell lines with V5-tagged JAGN1 have been established

• Protein detection methods:

  • Antibodies: Rabbit polyclonal antibodies against JAGN1 are available for Western blot, IHC-P, and ICC/IF applications

  • Flow cytometry: Intracellular staining has been used to confirm protein loss in plasma cells

  • Immunohistochemistry: V5-tagged JAGN1 can be visualized to determine subcellular localization

• Functional assays:

  • Assessment of glycosylation: Measuring sialylation and fucosylation of proteins

  • ER stress markers: Monitoring XBP1 splicing, a key indicator of ER stress

  • Golgi structure analysis: Using Golgi Cytopainter dye to measure Golgi content by flow cytometry

  • Antibody secretion: Quantifying intracellular and secreted immunoglobulins

How does JAGN1 deficiency affect B cell function and antibody production?

JAGN1 deficiency has significant effects on B cell function and antibody production:

• Reduced antibody production and secretion:

  • JAGN1-deficient B cells show substantial reduction in intracellular and secreted immunoglobulins upon stimulation

  • Transcript levels for both membrane (μM) and secreted (μS) mRNA species remain comparable, suggesting post-transcriptional effects

• Altered plasma cell development:

  • JAGN1 deficiency leads to markedly reduced levels of bone marrow plasma cells (Lin−CD28+CD138+)

  • Remaining JAGN1-deficient plasma cells exhibit lower levels of intracellular IgM and reduced BLIMP1 protein levels

  • In mixed bone marrow chimeric mice, JAGN1-deficient cells are depleted in CD28+CD138+ plasma cells in both spleen and bone marrow

• ER stress and altered ER architecture:

  • JAGN1-deficient plasmablasts show increased ER stress as evidenced by enhanced XBP1 splicing and increased spliced XBP1 protein levels

  • Electron microscopy reveals massively altered ER structure in JAGN1-deficient plasmablasts

  • RNA sequencing of JAGN1-deficient plasmablasts shows upregulation of stress response genes, apoptosis, protein folding, and unfolded protein response genes

• Aberrant antibody glycosylation:

  • JAGN1 deficiency results in aberrant IgG N-glycosylation leading to enhanced Fc receptor binding

  • It particularly affects fucosylation of IgG subtypes in mice and in patients with JAGN1 mutations

  • Even JAGN1-deficient patients with normal serum immunoglobulin levels demonstrate altered immunoglobulin glycoprofiles

JAGN1 deficiency in humans manifests as severe congenital neutropenia with various additional clinical features:

• Primary immunodeficiency:

  • Recurrent infections (bacterial and fungal)

  • Sepsis, abscesses, pneumonia, otitis media, sinusitis

  • Poor response to G-CSF treatment

• Hematological abnormalities:

  • Extremely low absolute neutrophil count (ANC), averaging around 100 cells/μl

  • Maturation arrest of neutrophils in bone marrow

  • In one case, bleeding manifestations including recurrent intracranial hemorrhage were observed

• Developmental issues:

  • Failure to thrive

  • Developmental delay

  • Short stature

• Other manifestations:

  • Facial dysmorphism

  • Skeletal abnormalities

  • Pancreatic insufficiency (in some cases)

What therapeutic approaches are being investigated for JAGN1-related disorders?

Several therapeutic approaches are being investigated for JAGN1-related disorders:

• Granulocyte Colony-Stimulating Factor (G-CSF):

  • Standard treatment for neutropenia but shows limited efficacy in JAGN1 deficiency

  • Many patients show poor response to G-CSF therapy

• Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF):

  • Restores phosphorylation of STAT5 and cytotoxicity against Candida albicans in JAGN1-deficient neutrophils

  • Reverses the phenotype of decreased myeloperoxidase expression and ineffective killing via neutrophil extracellular traps

• Immunoglobulin Replacement Therapy:

  • Recommended even for JAGN1-deficient patients with normal serum immunoglobulin levels due to altered glycosylation profiles

  • Addresses antibody deficiency seen in some patients with JAGN1 mutations

• Hematopoietic Stem Cell Transplantation:

  • Considered curative for severe congenital neutropenia caused by JAGN1 deficiency

  • May be warranted in patients with erratic neutrophil counts despite G-CSF treatment and recurrent severe infections

• Targeting ER Stress Pathways:

  • Research suggests that addressing the increased ER stress in JAGN1-deficient cells might be a potential therapeutic approach

  • Strategies to modulate the unfolded protein response pathway could potentially improve cellular function