Recombinant Protein kleE (kleE) is a bioengineered protein produced through recombinant DNA technology. It is synthesized in Escherichia coli (E. coli) and features an N-terminal His-tag for purification and structural stability . The protein spans 109 amino acids (Residues 1–109) and corresponds to the UniProt identifier Q52280. While its specific biological function remains understudied, its design aligns with broader applications in molecular biology, diagnostics, and therapeutic research .
The amino acid sequence of kleE is:
MSNIVKFPRASKPPAPEPVQPAAPAAAPAAPKAEGRGLVAGLVKFVWVATVLVWPVLKWV LAIITFFQFVRMLYHWNTPGVYAGWSFLAYFAALTAITYFVSIYKPKGL .
| Parameter | Value/Description |
|---|---|
| Length | Full-length (1–109 amino acids) |
| Tag | N-terminal His-tag |
| Molecular Weight | ~12 kDa (estimated from AA composition) |
| Source Organism | E. coli |
| Purity | >90% (SDS-PAGE confirmed) |
The His-tag facilitates affinity chromatography purification, a common method in recombinant protein production .
kleE is expressed in E. coli, leveraging its cost-efficiency and rapid growth . Key steps include:
Cloning: Insertion of the kleE gene into a plasmid vector (e.g., pET series) under a strong promoter (e.g., T7) .
Expression: Induction of protein synthesis via IPTG or lactose analogs in strains like BL21(DE3), which lack proteases and optimize folding .
Purification: His-tag affinity chromatography to isolate the protein from cellular contaminants .
| Host System | Advantages | Limitations |
|---|---|---|
| E. coli | Fast growth, low-cost, high yield | Limited post-translational modifications |
| Yeast | Proper folding, glycosylation | Slower growth, higher cost |
| Mammalian cells | Complex modifications (e.g., disulfides) | Low yield, high expense |
E. coli remains the preferred host for kleE due to its simplicity and compatibility with His-tag purification .
While kleE’s specific roles are not extensively documented, recombinant proteins with similar designs are used in:
Structural Biology: Crystallization studies to determine 3D structures .
Diagnostic Assays: Antigen in immunoassays (e.g., ELISA, Western blot) .
Therapeutic Development: Screening for drug interactions or enzyme activity .
| Parameter | Specification |
|---|---|
| Purity | >90% (SDS-PAGE) |
| Storage | -20°C or -80°C (lyophilized powder) |
| Reconstitution | Deionized water (0.1–1.0 mg/mL) |
| Stability | Avoid repeated freeze-thaw cycles |
The protein is lyophilized in a Tris/PBS-based buffer with 6% trehalose to enhance stability .
Protein Folding: E. coli may misfold proteins, requiring chaperones or optimized expression conditions .
Yield Optimization: BL21(DE3) and Rosetta strains improve rare codon usage and expression efficiency .
The His-tag enables high-purity isolation via nickel affinity chromatography, a critical step in reducing contamination .
The selection of an appropriate expression vector is critical for successful recombinant protein production. Common expression plasmids are derived from various combinations of replicons, promoters, selection markers, multiple cloning sites, and fusion protein strategies . The pET series vectors, which contain the pMB1 origin (15-60 copies per cell), are extremely popular and can yield target proteins comprising up to 50% of total cell protein in successful cases .
For tighter expression control, consider the pQE vectors from Qiagen, which utilize the wild-type ColE1 origin (15-20 copies per cell) and incorporate two lac operator sequences to increase control of the T5 promoter . When planning dual protein expression, vectors with the p15A origin (such as pACYC and pBAD series, 10-12 copies per cell) can be used alongside ColE1-based vectors since they belong to different incompatibility groups . For particularly challenging expression scenarios, triple expression is possible using the pSC101 plasmid .
Promoter selection should be based on your specific experimental requirements regarding expression level, induction timing, and protein toxicity. The T7 promoter system in pET vectors is widely used due to its capacity for high-level expression . In this system, the gene of interest is cloned downstream of a promoter recognized by phage T7 RNA polymerase, which must be provided either by another plasmid or, more commonly, from a prophage (λDE3) integrated into the bacterial genome .
For proteins that may be toxic to the host cell, tighter regulation can be achieved through several mechanisms:
Using the lambda pL promoter system, which is regulated by the λcI repressor protein and can be induced by nalidixic acid or temperature shifts
Employing the araBAD promoter system, which offers tunable expression in response to arabinose concentration
Adding glucose (0.2-1% w/v) to suppress leaky expression from lac-based promoters
Co-expressing T7 lysozyme from pLysS or pLysE plasmids to inhibit basal T7 RNA polymerase activity
The choice of E. coli strain significantly impacts expression outcomes. For T7 promoter-based systems, BL21(DE3) and its derivatives are commonly used as they contain the λDE3 prophage for T7 RNA polymerase expression . For tight control of potentially toxic proteins, the Lemo21(DE3) strain allows tunable expression by modulating T7 lysozyme levels .
When designing an expression system, remember that multiple conditions may need to be tested. If your project requires testing two protein constructs in six different expression vectors and three different expression strains, you would need to perform 36 expression trials . High-throughput small-scale screening in 2-ml tubes or 96-well plates can accelerate this optimization process .
In LTRS analysis of recombinant protein expression in E. coli, the intensities of protein-associated Raman bands (such as those at 1004, 1449, and 1610 cm^-1) increase significantly after induction, correlating with protein accumulation . This spectroscopic approach can detect protein expression earlier than Western blotting, making it valuable for time-course studies of expression dynamics .
Selection markers are essential for maintaining plasmids in host cells. While ampicillin resistance (conferred by the bla gene) is commonly used, the β-lactamase enzyme is continuously secreted, leading to antibiotic degradation within hours . This degradation can allow plasmid-free cells to proliferate during extended cultivation .
Other selection markers may have similar limitations if resistance is based on antibiotic degradation, as might be the case with chloramphenicol and kanamycin . Tetracycline has been shown to be more stable during cultivation since resistance is based on active efflux of the antibiotic from resistant cells rather than degradation .
Optimizing recombinant protein expression requires a systematic approach to testing multiple variables. Consider the following strategy:
Initial small-scale screening: Perform micro-expression trials in 2-ml tubes or 96-well plates to rapidly test multiple conditions before scale-up .
Vector and strain selection: Test combinations of:
Expression monitoring: Use time-course analysis to determine optimal harvest time. SDS-PAGE can identify protein accumulation patterns, while LTRS can detect expression at the single-cell level .
A high-throughput approach using automated liquid handling systems can allow testing of over 1000 culture conditions within a week . After identifying promising conditions, verify reproducibility in larger-scale cultures before proceeding to production scale.
Expression of toxic proteins presents significant challenges that can be addressed through several strategies:
Tight transcriptional control: Use tightly regulated promoters like araBAD or employ multiple levels of control as in the T7/lac hybrid promoter system .
Tunable expression systems: The Lemo21(DE3) strain allows fine-tuning of expression levels by modulating T7 lysozyme production, enabling expression just below the toxicity threshold .
Lower copy number plasmids: Reducing plasmid copy number decreases basal expression. Consider vectors with p15A or pSC101 origins .
Glucose supplementation: Adding 0.2-1% glucose to growth media suppresses leaky expression from lac-based promoters by catabolite repression .
Specialized host strains: Some E. coli strains are better equipped to handle toxic proteins due to modifications in cellular machinery or stress response pathways .
For severely toxic proteins, consider alternative expression hosts such as plant-based systems using agroinfiltration techniques with Agrobacterium tumefaciens and Nicotiana benthamiana .
Recombinant protein accumulation follows distinct temporal patterns during batch culture. LTRS studies have shown that protein-associated Raman bands intensify as culture time increases, correlating with protein accumulation . In E. coli expression systems, the relative amounts of recombinant protein are typically low in the first 4-12 hours post-induction, followed by dramatic increases at 20-24 hours .
This temporal pattern has been confirmed through conventional SDS-PAGE analysis, which shows minimal protein accumulation in the first 12 hours post-induction, with significant increases between 12-24 hours . Time-course analysis reveals that certain Raman bands associated with nucleic acids (783, 1099, and 1573 cm^-1) may decrease at later time points (24 hours post-induction), possibly reflecting changes in cellular metabolism as resources are diverted to recombinant protein production .
For optimal yield, harvest timing should be determined empirically through time-course studies, as extended expression periods may lead to protein degradation, inclusion body formation, or loss of cell viability.
When evaluating different expression hosts, consider both quantitative output and qualitative characteristics of the recombinant protein. LTRS has been used to compare recombinant protein expression between E. coli and Pichia pastoris (yeast) systems . In both hosts, increased intensities of protein-associated Raman bands were observed following induction, though with different temporal dynamics .
While E. coli typically produces recombinant proteins faster, yeast systems often provide superior post-translational modifications. In P. pastoris expressing recombinant somatolactin, a unique Raman band at 974 cm^-1 appears after induction, possibly representing molecules associated with eukaryotic protein expression pathways . This band increases linearly with culture time, providing a convenient marker for expression monitoring .
Western blotting analysis of yeast systems typically shows detectable protein levels only after extended culture periods (>17 hours post-induction), while LTRS can detect expression changes earlier . This highlights the value of spectroscopic methods for comparative studies across expression platforms.
While E. coli remains the most popular expression platform, alternative systems offer advantages for specific applications. For proteins requiring eukaryotic post-translational modifications, yeast systems like P. pastoris provide a balance between bacterial simplicity and eukaryotic processing capability .
Plant-based transient expression systems using agroinfiltration technology (ATT) represent another valuable alternative. These systems utilize Agrobacterium tumefaciens to deliver genes to plant cells, particularly Nicotiana benthamiana . A typical ATT research and development kit includes:
A binary vector with a multiple cloning site for flexible gene integration
A disarmed A. tumefaciens strain compatible with the binary vector
N. benthamiana seeds
This approach is particularly useful for proteins that benefit from plant-specific post-translational modifications or those that are toxic to microbial hosts. The workflow involves molecular cloning, preparation of Agrobacterium cultures, infiltration of plant tissues, and harvest of the recombinant protein from plant biomass .