Recombinant Protein MgtC (mgtC)

Shipped with Ice Packs
In Stock

Description

Biochemical Functions of MgtC

MgtC modulates cellular processes critical for pathogen survival:

Regulation of ATP Synthesis and Cytosolic pH

In Salmonella, MgtC binds the F₁F₀ ATP synthase α-subunit, inhibiting ATP-driven proton translocation and NADH-driven ATP synthesis. This maintains physiological ATP levels and prevents cytoplasmic acidification . A Salmonella mgtC mutant exhibits elevated ATP and acidic cytoplasm .

Phosphate Uptake Activation

MgtC interacts with PhoR histidine kinase, activating phosphate transport independently of environmental phosphate levels. A PhoR mutant lacking MgtC binding abolishes this effect .

Mg²⁺ Deprivation Adaptation

Though MgtC is induced under Mg²⁺ deprivation, it does not function as a Mg²⁺ transporter. Its role in this context remains unclear but may involve stress response pathways .

Role in Pathogenesis Across Pathogens

MgtC is essential for intramacrophage survival in multiple pathogens:

PathogenMgtC FunctionExperimental Evidence
Salmonella entericaATP regulation, phosphate uptake, PhoP protectionMacrophage survival defect in mgtC mutants
Mycobacterium tuberculosisMg²⁺ deprivation adaptationGrowth impairment in low Mg²⁺ media
Yersinia pseudotuberculosisGrowth under Mg²⁺ starvationComplementation restores growth defects
Pseudomonas aeruginosaBiofilm formation regulationmgtC mutants show altered biofilm dynamics

Negative Regulation by MgtR and CigR

  • MgtR: A hydrophobic peptide encoded by the mgtCB operon promotes MgtC degradation via FtsH protease . Overexpression of MgtR reduces MgtC levels and Salmonella replication in macrophages .

  • CigR: In Salmonella, CigR binds MgtC, preventing its interaction with the F₁F₀ ATP synthase. Early infection phases prioritize CigR to suppress MgtC’s ATP-lowering effects .

Transcriptional Induction

The mgtCB operon is induced under Mg²⁺ deprivation and intracellular environments. In Salmonella, PhoP activates mgtCB transcription, while CigR counteracts this by degrading PhoP .

Vaccine Development

Immunization with Mycobacterium abscessus recombinant MgtC reduces pulmonary infection in cystic fibrosis (CF) mice, suggesting vaccine potential .

Antivirulence Strategies

  • MgtR Peptides: Synthetic MgtR derivatives inhibit MgtC by promoting its degradation. These peptides reduce Salmonella survival in macrophages .

  • PhoR Inhibition: Targeting MgtC-PhoR interaction disrupts phosphate transport, altering Salmonella pathogenesis .

Key Research Findings and Mechanistic Models

DiscoveryImplicationReference
MgtC inhibits F₁F₀ ATP synthase activityMaintains ATP homeostasis in Salmonella
MgtC activates phosphate transport via PhoREnhances nutrient acquisition in host cells
MgtC degradation by MgtR/FtsHNegative feedback loop regulates virulence

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize the development of the specified tag.
Synonyms
mgtC; STY4022; t3754; Protein MgtC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Salmonella typhi
Target Names
mgtC
Target Protein Sequence
MEERMLMFPYILNLLAAMLLGALIGAERQWRQRMAGLRTNALVATGAAVFILSSMTTSPD SPGRIAAQIVSGIGFLGAGVIMREGMNVRGLNTAATLWCSAGIGVLCGLGQFKNALAATI IILCANILLREAAQRINQLPVSAEAEKRYILKVTCNKEDESAVRQWLLNIVKEAAICLQG LGSVPAQEQGYKEIRAELVGHADYRKTRELIISRIGDNDNITAIHWSIDSQ
Uniprot No.

Target Background

Function
MgtC is a virulence factor essential for bacterial growth in low Mg(2+) environments and for survival within macrophages. It may play a role in regulating membrane potential by activating the Na(+)/K(+)-ATPase.
Database Links

KEGG: stt:t3754

STRING: 220341.STY4022

Protein Families
MgtC/SapB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MgtC and what is its significance in bacterial pathogenesis?

MgtC is a virulence factor required for intramacrophage replication of intracellular pathogens and growth in low Mg²⁺ medium . It was first identified in Salmonella enterica serovar Typhimurium (S. Typhimurium) where it plays an essential role in intramacrophage survival and long-term systemic infection in mice . The protein's importance extends beyond Salmonella, as MgtC homologues have been found in diverse γ-proteobacteria, including both intracellular and extracellular pathogens such as Yersinia pestis, Photorhabdus luminescens, and Pseudomonas aeruginosa .

What is the structural organization of the MgtC protein?

MgtC belongs to a family of proteins that share a conserved N-terminal transmembrane domain and a variable C-terminal domain . Structural analysis of the Salmonella MgtC reveals:

  • The N-terminal region contains multiple hydrophobic transmembrane segments that anchor the protein in the bacterial inner membrane

  • The C-terminal domain is cytoplasmic and adopts a fold also found in metal transporters and RNA interacting domains

  • Despite its role in magnesium homeostasis, the C-terminal domain does not directly bind Mg²⁺

  • A cytoplasmic loop between the third and fourth transmembrane domains has been identified as functionally important for protein-protein interactions

How is MgtC expression regulated in bacteria?

MgtC expression is regulated through sophisticated mechanisms operating at both transcriptional and post-transcriptional levels:

  • Transcriptional regulation: In S. enterica, MgtC is coexpressed with the MgtB magnesium transporter as part of the mgtCB operon, which is induced by magnesium deprivation .

  • Post-transcriptional regulation: Despite high levels of mgtCB transcriptional induction in magnesium-depleted medium, the MgtC protein is hardly detected in wild-type Salmonella strains due to a negative feedback mechanism .

  • Peptide-assisted degradation: A small hydrophobic peptide called MgtR, encoded within the mgtCB operon, promotes MgtC degradation by interacting with the protein and facilitating its proteolysis by the FtsH protease .

This multilevel regulation ensures precise control of MgtC protein levels during bacterial adaptation to different environments.

How does MgtC contribute to bacterial survival in different environments?

MgtC exhibits a dual functional role that can be experimentally dissociated:

  • Macrophage survival: MgtC is essential for bacterial replication within macrophages, a hostile environment for bacterial pathogens . This function appears to be independent of its role in magnesium homeostasis.

  • Growth in low Mg²⁺ conditions: MgtC enables bacterial growth in magnesium-depleted environments, with Salmonella ΔmgtC strains showing elongated and autoaggregated bacteria in low Mg²⁺ medium but not in macrophages .

Complementation studies with MgtC homologues from different bacterial species have revealed functional specialization. For example, Y. pestis MgtC fully complemented the Salmonella MgtC in both environments, whereas P. luminescens or P. aeruginosa MgtC only complemented in low Mg²⁺ medium . This suggests evolutionary adaptation of MgtC function across bacterial species.

What methodologies can be used to study MgtC-protein interactions?

Several experimental approaches have proven effective for investigating MgtC interactions:

  • Bacterial two-hybrid assays: The bacterial adenylate cyclase-based two-hybrid (BACHT) system has been successfully employed to demonstrate the interaction between MgtC and the regulatory peptide MgtR . This system is particularly valuable for studying interactions between membrane proteins in their native environment.

  • Site-directed mutagenesis: Targeted mutations in both MgtC and its interacting partners can identify critical residues for protein-protein interactions. Researchers have identified mutations in MgtR (L15R, A24R) and MgtC (E84A, G85A, N92T) that prevent their interaction .

  • Correlation studies: Comparing the effects of mutations on both physical interaction (measured by two-hybrid assays) and functional consequences (protein degradation) provides insights into structure-function relationships .

How can researchers distinguish between the dual functions of MgtC experimentally?

To differentiate between MgtC's roles in macrophage survival and magnesium homeostasis, researchers can employ the following methodological approaches:

  • Complementation with heterologous MgtC proteins: Express MgtC homologues from various bacterial species in a Salmonella ΔmgtC strain and assess complementation in both macrophage survival and low Mg²⁺ growth assays .

  • Site-directed mutagenesis: Generate single amino acid changes that affect one function but not the other. Specific mutations have been identified that prevent or promote MgtC's role in macrophages without affecting its function in low Mg²⁺ medium .

  • Phenotypic analysis: Compare bacterial morphology and behavior (such as elongation and autoaggregation) in macrophages versus low Mg²⁺ medium .

What controls should be included when studying MgtC expression?

When designing experiments to study MgtC expression, several controls should be implemented:

  • Magnesium concentration controls: Compare bacterial growth and protein expression in both low (10 μM) and high (10 mM) Mg²⁺ conditions .

  • Gene expression controls: Include analysis of non-PhoP-regulated genes (e.g., gapA) as controls when examining mgtC transcription in response to magnesium levels .

  • Protein specificity controls: Measure levels of co-expressed proteins (e.g., MgtB) to confirm the specificity of regulatory effects. MgtR specifically affects MgtC but not MgtB protein levels .

  • Time course controls: Monitor MgtC expression at different time points, as MgtC can be detected after limited Mg²⁺ starvation (2-4 hours) but may not be expressed after prolonged starvation (16 hours) .

How should experiments be designed to study MgtR-mediated regulation of MgtC?

To investigate the regulatory relationship between MgtR and MgtC, researchers should consider the following experimental design principles:

  • Genetic manipulation: Compare MgtC expression in wild-type strains versus strains with altered MgtR expression (deletion or overexpression) .

  • Time-course analysis: Conduct kinetic experiments to determine the temporal dynamics of MgtR-assisted MgtC degradation .

  • Protease dependency: Include strains with defective FtsH protease to confirm the role of this protease in MgtR-mediated MgtC degradation .

  • Structural analysis: Introduce mutations in the hydrophobic transmembrane domain of MgtR (especially targeting the Ala-coil motif) to assess the structural requirements for MgtR function .

Mutation in MgtREffect on MgtC DegradationEffect on MgtC-MgtR InteractionMembrane Localization
L15RAbolishedAbolishedImpaired
A24RAbolishedAbolishedMaintained
L15PReducedReducedNot reported
A24PReducedReducedNot reported

How can researchers analyze contradictory findings about MgtC function?

When confronted with seemingly contradictory data regarding MgtC function, researchers should consider:

  • Experimental context: Differentiate between in vivo (macrophage) and in vitro (low Mg²⁺ medium) conditions, as MgtC may function differently in each environment .

  • Genetic background: Consider strain-specific differences and the presence of compensatory mechanisms in different bacterial species.

  • Functional dissociation: Remember that MgtC's dual functions can be experimentally separated, as demonstrated with heterologous complementation experiments .

  • Statistical analysis: Apply appropriate statistical methods for analyzing high-dimensional data, such as those generated from microarray experiments studying global expression patterns including MgtC .

What statistical approaches are appropriate for analyzing MgtC expression data?

For robust analysis of MgtC expression data, particularly from high-throughput experiments, researchers should follow statistical best practices:

  • Experimental design considerations: Ensure proper replication and randomization to control for technical and biological variability .

  • Normalization techniques: Apply appropriate normalization methods to account for systematic biases in expression data .

  • Statistical inference: Use appropriate statistical tests that account for multiple testing when analyzing differential expression .

  • Correlation analysis: When examining relationships between MgtC expression and other variables (e.g., bacterial survival), apply correlation analyses while being cautious about inferring causation .

As Fisher noted, "The statistician cannot excuse himself from the duty of getting his head clear on the principles of scientific inference, but equally no other thinking man can avoid a like obligation" . This principle applies equally to researchers studying MgtC expression.

What challenges are associated with producing recombinant MgtC protein?

Producing recombinant MgtC presents several technical challenges:

  • Membrane protein expression: As an inner-membrane protein with multiple transmembrane domains, MgtC can be difficult to express in heterologous systems.

  • Protein folding: Ensuring proper folding and membrane insertion of recombinant MgtC requires careful optimization of expression conditions.

  • Purification challenges: The hydrophobic nature of MgtC necessitates specialized detergent-based purification protocols.

  • Functional validation: Confirming that recombinant MgtC retains its native structure and function requires appropriate assays for both its roles in macrophage survival and magnesium homeostasis.

How can researchers identify novel interaction partners for MgtC?

To discover previously unknown MgtC interaction partners, researchers can employ these methodological approaches:

  • Expanded bacterial two-hybrid screening: Use the BACHT system that has successfully demonstrated MgtC-MgtR interaction to screen for additional partners .

  • Co-immunoprecipitation: Perform pull-down assays with tagged MgtC to identify proteins that physically interact with it in different environmental conditions.

  • Cross-linking studies: Use chemical cross-linking combined with mass spectrometry to identify transient or weak interactions.

  • Suppressor mutant screening: Identify mutations that suppress the phenotypic defects of mgtC mutants, potentially revealing functional relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.