Recombinant Protein mxiG (mxiG)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant proteins are manufactured proteins produced by cells that have been engineered with a specific gene, serving as a vital tool in scientific research . Recombinant DNA technology is used to produce them, and they are encoded by recombinant DNA clones into an expression vector . MxiG is a protein component of the type III secretion system (T3SS) in Shigella bacteria . Specifically, MxiG is an inner-rod (IR) protein . The T3SS is essential for the virulence of Shigella, as it allows the bacteria to inject proteins into host cells, facilitating invasion and infection .

MxiG's Role in the Type III Secretion System

MxiG is crucial for the assembly and function of the Shigella T3SS, particularly in the formation of the secretion apparatus (SP) . It interacts with other proteins, such as MxiK, to form a bridge between the Spa33 pod protein and the MxiG IR protein, a process required for SP assembly .

Interaction with MxiK

The cytoplasmic domain of MxiG interacts with MxiK, directing the assembly of the T3SS apparatus . The interface between MxiK and MxiG in Shigella differs from that of homologous proteins (OrgA and PrgH, respectively) in Salmonella . The interaction between MxiG and MxiK is critical for restoring Shigella's virulence activities in vivo .

In vitro Interaction

An in vitro interaction between MxiG C and full-length MxiK was confirmed, although recombinant MxiK was unstable when expressed in E. coli . To overcome this, a fusion protein (MxiK-T4L-C) was created by fusing MxiK with bacteriophage T4 lysozyme (T4L) at its C terminus . This fusion protein was able to bind MxiG C with a dissociation constant of 19.9 μm, suggesting a transient or dynamic interaction .

Binding Specificity

Peptides from a library spanning the length of MxiK were tested for their ability to bind to MxiG C using biolayer interferometry (BLI) . Three peptides from this library showed specific binding to MxiG C, all localized to a region within the N-terminal half of MxiK .

Table 1: Binding of MxiK Peptides to MxiG C

Peptide Location (MxiK Residues)Dissociation Constant (Kd)
30-60Micromolar range
N-terminal half of MxiKSpecific binding

Functional Significance

The FHA domain of MxiG is responsible for its phosphopeptide-independent interactions with the MxiK adaptor protein of the SP . The flexibility of the MxiG linker, which connects MxiG C with its transmembrane helix, likely contributes to the dynamics that guide type III secretion in Shigella .

Implications for Drug Discovery

Understanding the structure and function of proteins like MxiG can aid in the discovery of novel therapeutics . By targeting the unique 3D structural motifs of bacterial proteins, it may be possible to develop compounds that selectively inhibit bacterial growth without harming human cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mxiG; Protein MxiG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Shigella sonnei
Target Names
mxiG
Target Protein Sequence
MSEAKNSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETLEFGNDNFPENIIPVTD SKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGISFHLKNMREDKSRGHILNG MYKNHSVFFFFAVIVVLIIIFSLSLKKDEVKEIAEIIDDKRYGIVNTGQCNYILAETQND AVWASVALNKTGFTKCRYILVSNKEINRIQQYINQRFPFINLYVLNLVSDKAELLVFLSK ERNSSKDTELDKLKNALIVEFPYIKNIKFNYLSDHNARGDAKGIFTKVNVQYKEICENNK VTYSVREELTDEKLELINRLISEHKNIYGDQYIEFSVLLIDDDFKGKSYLNSKDSYVMLN DKHWFFLDKNK
Uniprot No.

Target Background

Function
Recombinant Protein mxiG is involved in the secretion of Ipa antigens and facilitates intracellular dissemination of Shigella. It is a component of the Mxi-Spa secretion apparatus.
Subcellular Location
Cell inner membrane; Single-pass type II membrane protein. Cell outer membrane; Single-pass type II membrane protein.

Q&A

What is the structural organization of MxiG in the Type III Secretion System?

MxiG is an inner ring (IR) protein of the Type III Secretion System with a distinct cytoplasmic domain (MxiG C) connected to a transmembrane helix by a flexible linker. The cytoplasmic domain contains a forkhead-associated (FHA) domain that mediates protein-protein interactions . The structural arrangement of MxiG within the basal body of the secretion apparatus positions it to interact with other components, particularly the adaptor protein MxiK, which connects MxiG to the Spa33 pod protein . This tripartite interaction is essential for the assembly of the sorting platform that directs secreted effectors through the secretion channel.

What experimental techniques are most effective for studying MxiG interactions?

Several complementary techniques have proven valuable for studying MxiG interactions:

  • Bio-Layer Interferometry (BLI): Useful for determining binding kinetics between MxiG C and peptides from MxiK, revealing dissociation constants in the micromolar range .

  • Fluorescence Polarization (FP): This technique has demonstrated higher sensitivity for MxiG-MxiK interactions, with observed dissociation constants as low as 0.15 μM for specific peptide interactions .

  • Bacterial Adenylate Cyclase Two-Hybrid (BACTH) System: Effective for initial screening of protein-protein interactions, though interactions with MxiG may develop slowly in this system .

  • In situ structural analysis: Cryo-electron microscopy has been instrumental in visualizing MxiG within the assembled complex, confirming its position and interactions .

Each technique offers different advantages, and researchers should consider using multiple approaches to fully characterize MxiG interactions.

How do you address the challenge of MxiK instability in recombinant protein production systems?

A significant challenge in studying MxiG-MxiK interactions is the inherent instability of recombinant MxiK when expressed in Escherichia coli expression systems. This protein frequently aggregates during purification, and refolding attempts are often unsuccessful . Researchers have developed several strategies to overcome this challenge:

  • Fusion protein approach: Creating a fusion of MxiK with bacteriophage T4 lysozyme (T4L) at its C-terminus (MxiK-T4L-C) has been shown to significantly improve stability and solubility while maintaining biological activity .

  • Peptide library screening: When full-length protein is unobtainable, using peptide libraries spanning the length of MxiK to identify interaction domains with MxiG C has proven effective. Specifically, peptides from the N-terminal half of MxiK have demonstrated binding activity with MxiG C .

  • Functional validation: Complementation studies in mxiK null Shigella flexneri strains can confirm that fusion constructs retain biological activity before proceeding with biochemical characterization .

What is the significance of the phosphorylation-independent FHA domain in MxiG function?

The forkhead-associated (FHA) domain in MxiG represents an interesting case of functional evolution. While canonical FHA domains are β-sandwich structures that typically bind phosphothreonine moieties in their protein binding partners, the FHA domain in MxiG appears to function in a phosphorylation-independent manner for its interactions with MxiK .

This phosphorylation-independent mechanism suggests that the FHA domain in T3SS components has evolved specialized functions distinct from the typical phospho-recognition roles seen in other cellular contexts. This adaptation likely facilitates the assembly of the sorting platform without requiring phosphorylation cascades, enabling more direct structural interactions. Researchers investigating this domain should consider:

  • Structure-function analysis: Mutational studies targeting conserved residues within the FHA domain to determine which are critical for MxiK binding.

  • Binding kinetics comparison: Comparative analysis between the binding properties of MxiG FHA domain and classical phospho-dependent FHA domains.

  • Evolutionary analysis: Examination of sequence conservation patterns across bacterial species to identify selection pressures on this domain.

How do you experimentally differentiate between stable and transient protein-protein interactions in the Type III Secretion System?

The moderately weak association between MxiG C and MxiK (dissociation constant of 19.9 μM) suggests that their interaction may be transient or dynamic in nature . Distinguishing between stable and transient interactions in the T3SS requires specialized experimental approaches:

TechniqueApplication for Stable InteractionsApplication for Transient InteractionsLimitations
Bio-Layer InterferometryProvides binding constants and kineticsCan detect weak interactions when properly optimizedMay miss very transient interactions
Crosslinking Mass SpectrometryCaptures spatial relationshipsCan "freeze" transient interactions for detectionMay create artifacts
Fluorescence Resonance Energy Transfer (FRET)Measures static proximityCan detect dynamic changes in protein proximityRequires fluorescent tagging
Hydrogen-Deuterium Exchange Mass SpectrometryMaps interaction interfacesReveals dynamic changes in protein conformationComplex data analysis
Single-molecule TrackingN/ADirectly observes dynamic assembly/disassemblyTechnically challenging

When studying MxiG interactions, the choice of technique should consider the potential dynamic nature of its associations with partners like MxiK.

What are the optimal conditions for expressing and purifying recombinant MxiG protein?

Successful expression and purification of recombinant MxiG, particularly its cytoplasmic domain (MxiG C), is critical for in vitro interaction studies. Based on published protocols, the following approach is recommended:

  • Expression system selection: The cytoplasmic domain of MxiG expresses well in standard E. coli systems, while the full-length protein (containing the transmembrane domain) requires specialized membrane protein expression systems.

  • Purification strategy: For MxiG C, a two-step purification involving immobilized metal affinity chromatography followed by size exclusion chromatography typically yields protein of sufficient purity for interaction studies .

  • Buffer optimization: MxiG C stability is enhanced in buffers containing:

    • 50 mM Tris-HCl, pH 7.5

    • 150 mM NaCl

    • 5% glycerol

    • 1 mM DTT or TCEP to maintain reduced cysteine residues

  • Quality control: Circular dichroism spectroscopy should be performed to confirm proper folding, particularly of the FHA domain within MxiG C.

How can research designs address the challenge of interpreting protein interaction data in complex molecular systems?

When studying MxiG interactions within the T3SS, researchers must carefully design experiments to avoid interpretational pitfalls. Drawing from principles of experimental design in complex systems , consider the following approaches:

  • Sequential processing step contrasts: Design experiments that contrast representations computed in immediately sequential processing steps. For example, compare MxiG in isolation, MxiG bound to MxiK, and the MxiG-MxiK-Spa33 complex .

  • Parametric relationships: Study qualitatively similar proteins that are parametrically related within a single processing stage, such as comparing wild-type MxiG with point mutants at key interface residues .

  • Avoid parallel operation contrasts: Be cautious when interpreting direct contrasts between qualitatively different representations processed at parallel stages (e.g., comparing MxiG and PrgH directly), as these comparisons cannot isolate individual operations .

  • Multiple complementary techniques: Employ diverse methodologies to triangulate findings and compensate for the limitations of individual approaches .

What computational approaches complement experimental studies of MxiG interactions?

Computational methods provide valuable insights that complement experimental approaches for studying MxiG:

  • Molecular dynamics simulations: These can model the flexibility of the MxiG linker region connecting the cytoplasmic domain to the transmembrane helix, helping to understand how this flexibility contributes to T3SS dynamics .

  • Protein-protein docking: In silico docking between MxiG C and MxiK can generate testable hypotheses about interaction interfaces, particularly useful when guided by experimental constraints from peptide binding studies .

  • Evolutionary coupling analysis: This approach can identify co-evolving residues between MxiG and its binding partners, suggesting functionally important interaction sites that may not be apparent from sequence conservation alone.

  • Structural bioinformatics: Comparative analysis of FHA domains across different proteins can highlight unique features of the MxiG FHA domain that enable its phosphorylation-independent interactions.

How do you validate the functional significance of specific MxiG-MxiK interactions identified in vitro?

Validating that protein interactions observed in vitro have physiological relevance requires systematic approaches:

  • Complementation studies: Introduce mutated versions of MxiG (targeting specific interaction residues) into mxiG null bacterial strains and assess restoration of T3SS function through secretion assays and virulence phenotypes .

  • Domain swapping experiments: Replace the MxiG interaction domains with homologous regions from related species to determine if species-specific interactions are functionally significant.

  • In situ structural analysis: Use cryo-electron microscopy of intact secretion systems to confirm that mutations disrupting interactions in vitro also affect complex assembly in the native context .

  • Temporal studies: Analyze the dynamics of complex formation during different stages of T3SS assembly and activation to determine when specific interactions become critical.

What are the common pitfalls in experimental design when studying multiprotein complexes like those involving MxiG?

Research on complex molecular systems like the T3SS presents several experimental design challenges:

  • Baseline condition selection: When designing contrasts between experimental conditions, carefully select baseline conditions that isolate the specific operation or component of interest .

  • Necessary operation requirement: Ensure that experimental tasks can only be accomplished if a particular representation is processed at a specific stage, allowing successful performance to imply that the representation has been processed at that stage .

  • Exclusive operations assumption: Recognize that operations in baseline or experimental conditions must be restricted to those sufficient for the task, otherwise "epiphenomenal" activity may confound results .

  • Interpretation of parallel operation contrasts: Understand that comparing operations occurring in parallel (such as comparing MxiG in Shigella with PrgH in Salmonella) cannot isolate individual components of the system and has limited value for identifying neural correlates of specific operations .

  • Protein stability artifacts: Be aware that fusion tags or stabilizing mutations may alter the natural dynamics of protein interactions, requiring careful validation .

What emerging technologies show promise for advancing MxiG research?

Several cutting-edge technologies offer new opportunities for understanding MxiG function and interactions:

  • Cryo-electron tomography: This technique allows visualization of T3SS structures in their native cellular context, providing insights into how MxiG is organized within the assembled secretion apparatus.

  • Time-resolved structural methods: Techniques such as time-resolved cryo-EM and time-resolved X-ray crystallography can capture dynamic changes in protein complexes during assembly or activation.

  • Integrative structural biology: Combining multiple structural techniques (X-ray crystallography, NMR, cryo-EM, crosslinking mass spectrometry) can provide more comprehensive models of complex assemblies.

  • Proximity labeling techniques: Methods like BioID or APEX can map the protein interaction neighborhood of MxiG in living cells, potentially revealing transient or context-dependent interactions.

How can understanding MxiG interactions contribute to broader knowledge of bacterial pathogenesis mechanisms?

Research on MxiG and its interactions provides insights beyond the immediate T3SS field:

  • Conserved assembly principles: The mechanisms by which MxiG participates in multi-protein complex assembly may reveal general principles applicable to other bacterial secretion systems or molecular machines.

  • Evolution of virulence mechanisms: Comparing MxiG interactions across different bacterial species illuminates how pathogenic mechanisms have evolved and adapted to different host environments.

  • Structure-based inhibitor design: Detailed understanding of MxiG-MxiK interactions could guide the development of small molecules that disrupt T3SS assembly, representing a novel approach to anti-virulence therapeutics.

  • Systems biology perspective: MxiG research contributes to a broader understanding of how bacteria integrate mechanical components (secretion apparatus) with regulatory networks to coordinate virulence programs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.