Recombinant Protein RER1 homolog (rer-1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Pathways

RER1 homolog acts as a sorting receptor in the early secretory pathway, ensuring quality control of membrane proteins:

  • ER Retention/Retrieval: Recognizes transmembrane domain (TMD) signals in unassembled protein subunits, retrieving them to the ER via COPI vesicles .

  • Disease Relevance:

    • Neurodegeneration: Modulates γ-secretase trafficking and amyloid-β (Aβ) production in Alzheimer’s disease .

    • Charcot-Marie-Tooth Disease: Regulates ER retention of misfolded PMP22 mutants (e.g., L16P) .

    • Parkinson’s Disease: Influences α-synuclein (αSyn) aggregation pathways .

Role in Sodium Channel Regulation

  • Purkinje Cell Dysfunction: Rer1 knockout mice exhibit reduced surface expression of voltage-gated sodium channels (Nav1.1 and Nav1.6), leading to motor deficits and neurodegeneration .

  • Mechanism: Rer1 ensures proper assembly of Nav channel subunits, preventing ER-associated degradation (ERAD) of unassembled complexes .

Interaction with γ-Secretase and APP

  • Aβ Modulation: Overexpression of RER1 reduces cell surface γ-secretase and immature APP, lowering Aβ secretion .

  • Therapeutic Target: RER1’s dual regulation of γ-secretase and APP positions it as a candidate for Alzheimer’s intervention .

PMP22 Mutant Retention

  • Pathogenic Mutants: Rer1 knockdown increases post-ER forms of PMP22(L16P)-GFP, exacerbating ER retention in Charcot-Marie-Tooth disease models .

Applications in Research

Recombinant RER1 homolog is widely used for:

  • Mechanistic Studies: Analyzing ER retrieval pathways via co-immunoprecipitation and trafficking assays .

  • Disease Modeling: Investigating neurodegenerative and neuromuscular disorders in C. elegans and mammalian systems .

  • Antibody Production: Generating polyclonal antibodies for Western blot (WB) and immunohistochemistry (IHC) .

Future Directions

  • Therapeutic Development: Targeting RER1 to modulate Aβ production without disrupting γ-secretase’s physiological roles .

  • Structural Biology: Cryo-EM studies to resolve RER1-substrate interactions .

Recombinant Protein RER1 homolog (rer-1) remains pivotal in dissecting ER-Golgi trafficking mechanisms and their implications in disease. Its conserved function across species underscores its utility in translational research.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rer-1; F46C5.8; Protein RER1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
rer-1
Target Protein Sequence
MDDGLRDRPGVTSRFFHSLEVKYQYYLDRLTPHTAFRWVIALISLVFFASRIILLQGFYI VAYAVGIYYLNLFLLFLTPSIDPALEFEDEDDGPVLPSKTNDEFRPFMRRLPEFKFWHSF MKATLIAITCTFFEFFDVPVFWPILVMYFFILTFLTLKRQIMHMIKYRYIPFTVGKPRMA GKEDTGKVVVG
Uniprot No.

Target Background

Function

May be involved in protein transport along the secretory pathway.

Database Links

KEGG: cel:CELE_F46C5.8

STRING: 6239.F46C5.8.2

UniGene: Cel.15070

Protein Families
RER1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is RER1 and what is its primary function in cells?

RER1 is a protein first identified in yeast as being involved in the retrieval of several ER-localized proteins. It functions primarily as a retention/retrieval factor that recognizes and binds to specific transmembrane domains (TMDs) of unassembled protein subunits, preventing their exit from the endoplasmic reticulum until proper complex assembly occurs . The human homolog of RER1 is a 196 amino acid integral membrane protein that maintains this essential function in mammalian cells, mediating quality control by ensuring that only properly folded and assembled protein complexes exit the ER .

In particular, RER1 is involved in the retention/retrieval of components of the γ-secretase complex, a multi-subunit protease complex implicated in Alzheimer's disease pathogenesis. RER1 specifically binds to the unassembled Pen2 subunit via its first transmembrane domain and retains it in the ER until proper γ-secretase complex assembly occurs .

How is the structure of RER1 characterized across species?

RER1 exhibits remarkable structural conservation across species, from yeast to humans. Human RER1 is predicted to have a W-shaped topology with four transmembrane domains (TMDs), with both the N-terminus and C-terminus located in the cytosol . This topology is critical for its function as an ER retention/retrieval receptor.

The human RER1 protein is capable of complementing yeast strains defective in Rer1p, indicating significant functional conservation despite evolutionary distance . This suggests the fundamental importance of the RER1-mediated retention mechanism in eukaryotic cells.

The central hydrophilic loop between transmembrane domains 2 and 3 (amino acids 89-120) contains a soluble domain that has been used to generate specific antibodies against RER1 . This region may play an important role in RER1's ability to recognize and bind to its various substrates.

What are the key domains of RER1 important for protein interactions?

RER1 interacts with its substrate proteins primarily through their transmembrane domains. Evidence from yeast and mammalian studies indicates that RER1 recognizes polar amino acids within the transmembrane domains of its targets . For example, the binding of RER1 to Pen2 is dependent on a crucial asparagine residue in Pen2's first transmembrane domain (TM1) .

This recognition mechanism allows RER1 to selectively bind to unassembled subunits of multimeric complexes. When these subunits are incorporated into their respective complexes, the polar residues in their transmembrane domains become masked, preventing RER1 binding and allowing the complex to exit the ER .

What expression systems are most effective for recombinant RER1 production?

For recombinant RER1 production, mammalian expression systems are generally preferred over bacterial systems due to RER1's multiple transmembrane domains and requirement for proper folding and post-translational modifications. Based on research methodologies, the following systems have been used successfully:

Mammalian Expression Systems:

  • Human embryonic kidney (HEK293) cells: Particularly useful for studying RER1 in the context of its natural cellular environment

  • Chinese hamster ovary (CHO) cells: Effective for high-yield production of properly folded RER1

When cloning human RER1 for expression studies, researchers have successfully amplified the cDNA from brain or kidney mRNA libraries using RT-PCR . For detection purposes, epitope tags such as V5 or Myc are commonly added to the C-terminus of RER1 .

How can I validate proper folding and function of recombinant RER1?

Validating proper folding and function of recombinant RER1 requires multiple approaches:

Functional Validation:

  • Complementation assays: Human RER1 should rescue phenotypes in yeast strains defective in Rer1p

  • Co-immunoprecipitation with known binding partners: Properly folded RER1 should interact with unassembled Pen2 but not with assembled γ-secretase components

  • Subcellular localization: Immunofluorescence should show ER and early Golgi localization patterns consistent with RER1's function

Biochemical Validation:

  • Size exclusion chromatography to confirm proper oligomeric state

  • Limited proteolysis to assess domain folding

  • Thermal stability assays to evaluate protein stability

When overexpressing RER1, a functional validation indicator is the observation of increased levels of unassembled Pen2 without changes in Pen2 mRNA levels, suggesting stabilization through RER1 binding .

What techniques are most effective for studying RER1-protein interactions?

Several techniques have proven effective for investigating RER1 interactions with target proteins:

Co-immunoprecipitation (Co-IP):
This technique has been successfully used to demonstrate the interaction between RER1 and its binding partners. For example, co-IP experiments showed that V5-tagged RER1 binds to Pen2 but not to other γ-secretase components (Nct, Aph1a, PS1), indicating its selective binding to unassembled subunits .

Reporter Protein Constructs:
Creating chimeric constructs like CD4-TM1 (CD4 fused with the first transmembrane domain of Pen2) has been effective for isolating and studying specific RER1 recognition motifs . These constructs allow for easier detection and quantification of RER1 binding.

RNA Interference:
siRNA-mediated knockdown of RER1 can be used to assess its role in protein retention. For example, RER1 knockdown resulted in increased cell surface expression of CD4-TM1, confirming RER1's role in ER retention .

Flow Cytometry:
FACS analysis has been used to quantify changes in surface expression of proteins following RER1 manipulation, providing a quantitative readout of RER1's retention function .

How does RER1 influence γ-secretase assembly and activity?

RER1 plays a crucial role in regulating γ-secretase assembly and activity through multiple mechanisms:

Retention of Unassembled Components:
RER1 specifically binds to and retains unassembled Pen2, a critical component of the γ-secretase complex . This retention is mediated by RER1's recognition of a polar asparagine residue in the first transmembrane domain of Pen2. Through this mechanism, RER1 ensures that only fully assembled γ-secretase complexes exit the ER.

Impact on γ-secretase Trafficking:
RER1 regulates the intracellular trafficking of γ-secretase. Overexpression of RER1 decreases γ-secretase localization on the cell surface, while RER1 knockdown increases cell surface γ-secretase levels . This trafficking control affects γ-secretase activity since the enzyme requires proper localization to access its substrates.

Effect on Complex Assembly:
Interestingly, overexpression of RER1 increases the levels of unassembled Pen2, which can subsequently promote γ-secretase assembly since Pen2 is rate-limiting for complex formation . This is reflected in altered ratios of immature to mature Nicastrin (Nct), with higher RER1 levels shifting the balance toward mature Nct, the complex-assembled form .

How does RER1 affect amyloid-β production in Alzheimer's disease models?

RER1 has significant effects on amyloid-β (Aβ) production, which is central to Alzheimer's disease pathogenesis:

Direct Impact on Aβ Secretion:

  • RER1 overexpression decreases Aβ secretion

  • RER1 knockdown increases Aβ secretion

This modulation occurs through two primary mechanisms:

  • Regulation of γ-secretase trafficking and activity: By controlling the localization of γ-secretase (which cleaves APP to generate Aβ), RER1 indirectly regulates Aβ production. When RER1 is overexpressed, less γ-secretase reaches the cell surface, resulting in decreased Aβ production .

  • Direct effects on APP processing: RER1 also influences APP trafficking and maturation. Increased RER1 levels decrease mature APP and increase immature APP, resulting in less surface accumulation of APP . Since APP must reach the cell surface and undergo endocytosis for amyloidogenic processing, this reduction in surface APP further contributes to decreased Aβ production.

These findings suggest that RER1 could be a potential therapeutic target for reducing Aβ production in Alzheimer's disease, possibly offering a safer approach than direct inhibition of secretases .

What are common issues when working with recombinant RER1 and how can they be resolved?

When working with recombinant RER1, researchers often encounter several challenges:

Low Expression Levels:

  • Issue: As a transmembrane protein, RER1 may express poorly in heterologous systems.

  • Solution: Optimize codon usage for the expression host, use strong promoters appropriate for membrane proteins, and consider adding an N-terminal signal sequence to enhance membrane insertion efficiency.

Improper Localization:

  • Issue: Recombinant RER1 may not properly localize to the ER when overexpressed.

  • Solution: Verify localization by co-staining with ER markers. If mislocalization occurs, check that trafficking signals are intact and consider using a lower expression level system to prevent saturation of trafficking machinery.

Protein Aggregation:

  • Issue: Multiple transmembrane domains of RER1 can lead to aggregation during purification.

  • Solution: Use mild detergents like digitonin or CHAPS rather than stronger ones like Triton X-100. Consider purifying RER1 in nanodiscs or amphipols to maintain its native structure.

Difficult Detection:

  • Issue: Native RER1 antibodies may have limited sensitivity.

  • Solution: Add epitope tags such as V5 or Myc to the C-terminus as successfully demonstrated in previous studies . Avoid N-terminal tags that might interfere with ER targeting signals.

How can I distinguish between direct and indirect effects of RER1 manipulation?

Distinguishing direct from indirect effects of RER1 manipulation requires careful experimental design:

Direct Effects Validation:

  • In vitro binding assays: Using purified components to demonstrate direct physical interaction between RER1 and putative binding partners

  • Mutagenesis studies: Creating point mutations in specific residues of RER1 or its potential binding partners (e.g., the asparagine residue in Pen2 TM1) to disrupt interaction specifically

  • Proximity labeling: Using BioID or APEX2 fused to RER1 to identify proteins in close proximity in living cells

Controlling for Indirect Effects:

  • Time-course experiments: Monitoring changes immediately after RER1 manipulation vs. delayed effects

  • Pathway inhibitors: Using inhibitors of related pathways to rule out indirect effects

  • Rescue experiments: Testing whether direct addition of purified RER1 can rescue phenotypes in RER1-depleted systems

For example, previous research demonstrated a direct effect of RER1 on Pen2 by showing that RER1 co-immunoprecipitated with Pen2 but not with other γ-secretase components, and that this interaction depended specifically on an asparagine residue in Pen2's TM1 .

What is the potential role of RER1 in other protein misfolding disorders?

Given RER1's critical function in ER quality control and protein trafficking, its role may extend beyond Alzheimer's disease to other protein misfolding disorders:

Potential Involvement in Neurodegenerative Diseases:
RER1's role in regulating γ-secretase and APP trafficking suggests it might influence other neurodegenerative conditions where protein processing and quality control are disrupted. Research could investigate RER1's function in:

  • Parkinson's disease, where misfolded α-synuclein accumulates

  • Huntington's disease, characterized by polyglutamine protein aggregation

  • Amyotrophic lateral sclerosis (ALS), involving SOD1 and TDP-43 misfolding

ER Stress and Unfolded Protein Response:
RER1 might play a protective role during ER stress by ensuring that unassembled or misfolded proteins are retained in the ER. Future studies could examine how RER1 expression and function change during ER stress conditions and whether modulating RER1 could mitigate the consequences of chronic ER stress in disease states.

Specific Research Approaches:

  • Generate conditional RER1 knockout models in disease-relevant tissues

  • Perform proteomics studies to identify the full spectrum of RER1 binding partners across different cell types

  • Develop small molecules that could modulate RER1 binding specificity for potential therapeutic applications

How might emerging technologies advance our understanding of RER1 biology?

Several cutting-edge technologies hold promise for deepening our understanding of RER1 biology:

Cryo-Electron Microscopy:
Structural determination of RER1 in complex with its binding partners would provide unprecedented insights into the molecular basis of its recognition specificity. This could reveal how RER1 selectively binds to unassembled subunits and releases them upon complex formation.

CRISPR-Based Screening:
Genome-wide CRISPR screens in the context of RER1 function could identify novel components of the ER retention/retrieval machinery and unexpected substrates of RER1-mediated quality control.

Live-Cell Imaging Techniques:
Advanced microscopy approaches like single-molecule tracking and super-resolution microscopy could reveal the dynamics of RER1-mediated trafficking in real-time, providing insights into how RER1 captures its substrates and delivers them to COPI vesicles for retrieval.

Integrative Multi-Omics:
Combining transcriptomics, proteomics, and metabolomics in systems with modulated RER1 levels could reveal broader cellular consequences of altered ER retention/retrieval beyond the currently known pathways, potentially uncovering new therapeutic targets.

In Silico Modeling: Computational approaches to predict transmembrane domain interactions could identify new potential substrates for RER1 recognition and help design peptides or molecules that could selectively modulate RER1 binding to specific targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.