Recombinant Protein sirB2 (sirB2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Protein Sir2

Recombinant Protein Sir2 (Silent Information Regulator 2) is a NAD+-dependent deacetylase belonging to the sirtuin family, conserved across archaea, bacteria, and eukaryotes . Originally identified in Saccharomyces cerevisiae for its role in transcriptional silencing and chromatin remodeling , Sir2 homologs have since been implicated in diverse biological processes, including DNA repair, metabolic regulation, and aging . Recombinant Sir2 proteins are engineered using heterologous expression systems to study their structure, enzymatic activity, and therapeutic potential .

Production and Purification Strategies

Recombinant Sir2 is typically expressed in E. coli or archaeal systems (e.g., Sulfolobus islandicus) using engineered vectors . Key steps include:

  • Vector Design: Synthetic promoters (e.g., P<sub>araS-SD</sub>) and multiple cloning sites (MCS) optimize expression .

  • Tagging Systems: Hexahistidine (6×His) tags enable affinity purification .

  • Activity Validation: Deacetylase assays using NAD+ and acetylated substrates (e.g., histones) .

Example Protocol:

  1. Clone sir2 gene into pSeSD vector with a 6×His tag and thrombin cleavage site .

  2. Transform into S. islandicus and induce with arabinose .

  3. Purify via nickel-affinity chromatography .

Key Functions:

  • DNA Repair: In mycobacteria, Sir2 enhances NHEJ efficiency by 2-fold and improves survival under ionizing radiation .

  • Transcriptional Silencing: Yeast Sir2 deacetylates histone H4K16, promoting heterochromatin formation .

  • Metabolic Regulation: Sir2 modulates cAMP-PKA signaling, affecting stress responses and lifespan .

Mechanistic Insights:

  • NAD+ Dependency: Sir2 hydrolyzes NAD+ to produce nicotinamide and O-acetyl-ADP-ribose during deacetylation .

  • Allosteric Regulation: Binding partners (e.g., Sir4) stabilize Sir2’s interdomain interface, boosting activity .

Table 1: Functional Studies of Recombinant Sir2

StudyKey FindingReference
NHEJ in MycobacteriaΔsir2 strains show 10-fold sensitivity to ionizing radiation in stationary phase
Yeast Lifespan RegulationSir2 phosphorylation via cAMP-PKA/CK2 pathways extends replicative lifespan
Substrate SpecificityRecombinant Sir2 deacetylates histones but not nucleosomes without cofactors

Table 2: Enzymatic Activity

ParameterValueConditions
K<sub>m</sub> (NAD+)50–100 µMIn vitro assays with H4 peptide
Optimal pH7.5–8.5Mycobacterial Sir2

Applications in Biotechnology and Medicine

  • Therapeutic Development: Targeting Sir2 homologs (e.g., human SIRT1) for age-related diseases .

  • Antimicrobial Strategies: Disrupting bacterial Sir2 in pathogens like M. tuberculosis to impair DNA repair .

  • Industrial Enzymes: Thermostable Sir2 variants from Sulfolobus for biocatalysis .

Challenges and Future Directions

  • Structural Flexibility: Sir2’s conformational changes during tetramerization (e.g., in SPARSA systems) complicate inhibitor design .

  • Species-Specific Roles: Functional divergence between yeast, bacterial, and human homologs necessitates tailored studies .

  • Delivery Systems: Optimizing viral vectors for recombinant Sir2 production in eukaryotic cells .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will prepare the protein accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
sirB2; STY1899; t1102; Protein SirB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Salmonella typhi
Target Names
sirB2
Target Protein Sequence
MTIAMLLTLHLICVALSVSLFVARYWWRYCGHALAAARWTRIVPPVIDTLLLLSGIGLIV KTHILPFTESGSWLTEKLFGVIIYIVLGFIALDYRQARSQQARFIAFPLALVVLYIIIKL ATTKIPLLG
Uniprot No.

Target Background

Function
Essential for maximal expression of sirC; not required for host cell invasion.
Database Links

KEGG: stt:t1102

STRING: 220341.STY1899

Protein Families
SirB2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is sirB2 and how does it relate to the broader sirtuin family?

SirB2 belongs to the evolutionarily conserved family of SIR2-like proteins (sirtuins), which function primarily as NAD-dependent deacetylases. Sirtuins were initially identified through studies of the yeast Sir2 protein, which regulates epigenetic gene silencing and has potential antiaging effects through suppression of rDNA recombination . The sirtuin family spans from prokaryotes to eukaryotes, with sirB2 likely representing a bacterial homolog similar to cobB, which has been studied in Salmonella typhimurium . Phylogenetic analysis has recently divided the SIR2 family into two main clades: one containing primarily eukaryotic sirtuins involved in cellular regulation, and another containing bacterial antiphage defense proteins .

How conserved is the structure and function of sirB2 across bacterial species?

SIR2-like proteins demonstrate remarkable conservation across evolutionary domains while exhibiting specialized functions. In a comprehensive analysis of 57,911 potential SIR2 family proteins detected across bacteria, archaea, and eukaryotes, researchers identified distinct subfamilies with conserved domains . For sirB2 specifically, structural conservation assessment requires:

DomainExpected Conservation LevelFunctional Implication
NAD-binding pocketHigh (>90%)Essential for enzymatic activity
Catalytic coreHigh (>85%)Determines reaction specificity
N-terminal regionModerate (<70%)May confer target specificity
C-terminal regionLow-Moderate (40-60%)Likely involved in protein interactions

When working with sirB2 from different bacterial sources, researchers should perform sequence alignment using tools like Muscle v5.1 and build maximum likelihood phylogenetic trees to assess evolutionary relationships .

What expression systems are optimal for recombinant sirB2 production?

For bacterial sirB2 expression, E. coli systems have proven effective for related sirtuins like cobB . When designing your expression protocol:

  • Choose BL21(DE3) or Rosetta strains to address potential codon bias issues

  • Optimize induction conditions (0.1-0.5mM IPTG, 16-25°C, 4-18 hours) to maximize soluble protein yield

  • Consider fusion tags (His6, GST, or MBP) to enhance solubility and facilitate purification

  • Evaluate specific buffer compositions containing 5-10% glycerol and reducing agents to maintain protein stability

Early studies with recombinant E. coli cobB demonstrated successful expression of functional protein capable of NAD-dependent enzymatic activity , suggesting similar approaches would be effective for sirB2.

What are the critical considerations for maintaining sirB2 enzymatic activity during purification?

Maintaining sirB2 enzymatic activity requires careful attention to buffer composition and handling procedures. Based on protocols developed for related sirtuins:

  • Include NAD+ (0.5-1mM) in purification buffers to stabilize the active site

  • Maintain reducing conditions with 1-5mM DTT or β-mercaptoethanol to protect catalytic cysteine residues

  • Avoid freeze-thaw cycles by preparing single-use aliquots

  • Consider adding BSA (0.1-0.5mg/ml) as a stabilizing agent for dilute protein solutions

Purified recombinant sirB2 should be tested for enzymatic activity immediately following purification, as activity can diminish over time. For activity assessment, researchers have successfully used radiolabeled NAD ([32P]NAD) to track substrate modification by related sirtuins .

How can I definitively distinguish between deacetylase and ADP-ribosyltransferase activities in sirB2?

Distinguishing between these activities requires multiple complementary approaches:

  • Coupled enzyme assays: Monitor NAD+ consumption and nicotinamide production using HPLC or fluorescence-based methods

  • Mass spectrometry analysis: Detect mass shifts in substrate proteins (loss of acetyl groups vs. addition of ADP-ribose)

  • Site-directed mutagenesis: Test conserved histidine residues critical for activity (conversion to tyrosine abolished ADP-ribosyltransferase activity in human SIRT2)

  • Direct product quantification: Establish a 1:1 correspondence between NAD consumption and deacetylated product formation

In studies with other sirtuins, researchers initially observed weak ADP-ribosyltransferase activity but later determined that the predominant function was NAD-dependent deacetylation . This pattern may hold true for sirB2 as well.

What are appropriate substrates for assessing sirB2 enzymatic activity?

Selection of appropriate substrates depends on sirB2's specific function and evolutionary relationships:

Substrate TypeRationaleDetection Method
Acetylated histone peptidesCommon substrates for eukaryotic sirtuinsHPLC, mass spectrometry
Bacterial acetylated proteinsMore physiologically relevantMass spectrometry, Western blot
BSA (as a model substrate)Previously used for sirtuin ADP-ribosylation assaysRadioactive labeling with [32P]NAD
5,6-dimethylbenzimidazoleUsed for bacterial cobT and cobB protein activity assaysSpectrophotometric methods

Previous studies with recombinant E. coli cobB and human SIRT2 demonstrated activity using BSA as a substrate when assessing ADP-ribosyltransferase activity . For deacetylase activity, acetylated histone tail peptides have proven effective with yeast Sir2p and Hst2p .

What approaches should I use to identify sirB2 interaction partners in bacterial systems?

Identifying physiological interaction partners requires multiple complementary techniques:

  • Affinity purification coupled with mass spectrometry: Use tagged recombinant sirB2 to pull down interacting proteins from bacterial lysates

  • Bacterial two-hybrid screening: Identify direct protein-protein interactions

  • Cross-linking mass spectrometry: Capture transient interactions and determine interaction interfaces

  • Co-immunoprecipitation with epitope-tagged sirB2: Validate interactions in native conditions

For sirtuins, interaction partners often provide clues to biological function. In yeast and bacterial systems, sirtuins interact with various proteins including histones and metabolic enzymes . When analyzing sirB2 specifically, focus on proteins involved in DNA maintenance, stress response, or antimicrobial defense based on recent findings regarding SIR2 protein involvement in antiphage systems .

How can I determine the critical residues for sirB2 substrate recognition?

Identifying substrate recognition determinants requires:

  • Structure-guided mutagenesis: Target conserved residues in predicted substrate-binding regions

  • Hydrogen-deuterium exchange mass spectrometry: Map protein regions that change conformation upon substrate binding

  • Kinetic analysis of substrate variants: Systematically modify substrate residues to determine specificity requirements

  • Computational docking and molecular dynamics: Predict and validate binding interfaces

For related sirtuins, conversion of a conserved histidine to tyrosine abolished enzymatic activity , suggesting critical catalytic residues are likely conserved in sirB2. Analysis should incorporate comparative approaches using the extensive sirtuin sequence database containing over 46,000 detected sirtuin homologs .

How might sirB2 function in bacterial defense systems against bacteriophages?

Recent phylogenetic analysis has revealed that certain SIR2 family proteins function within bacterial antiphage defense systems . For sirB2's potential role:

  • Genomic context analysis: Examine if sirB2 is located near known antiphage systems (12-fold enrichment observed for certain SIR2 clades)

  • Functional testing: Assess if sirB2 expression affects phage infection efficiency

  • Protein localization studies: Determine if sirB2 relocates during phage infection

  • Target identification: Investigate if sirB2 modifies phage proteins through deacetylation or ADP-ribosylation

The discovery that SIR2 proteins cluster into two major clades, with one clade significantly enriched in genes associated with antiphage systems , suggests sirB2 may have specialized functions in bacterial immunity depending on its phylogenetic placement.

What experimental approaches can determine if sirB2 affects bacterial resistance to environmental stressors?

To investigate stress-response functions:

  • Gene deletion/complementation studies: Compare wild-type, sirB2-knockout, and complemented strains under various stressors

  • Transcriptomics: Analyze expression changes in response to stress with RNA-seq

  • Metabolic profiling: Measure NAD+/NADH ratios and key metabolites in different conditions

  • Protein acetylation landscape: Use acetylome analysis to identify targets deacetylated during stress

Sirtuins often function as metabolic sensors through their NAD+ dependency , suggesting sirB2 may similarly link metabolism and stress responses in bacteria.

How can I address inconsistent enzymatic activity in recombinant sirB2 preparations?

Inconsistent activity often stems from protein quality and assay conditions:

  • Protein quality assessment: Verify proper folding using circular dichroism and thermal shift assays

  • NAD+ quality: Use fresh NAD+ preparations and verify concentration spectrophotometrically

  • Cofactor requirements: Test various metal ions (Zn2+, Mg2+) and reducing agents

  • Storage optimization: Determine optimal buffer components for long-term stability

Early studies with sirtuins required the presence of additional proteins for activity , suggesting sirB2 may similarly require specific conditions or cofactors for optimal function.

What controls are essential when assessing sirB2 enzymatic activity?

Essential controls include:

  • Negative controls:

    • Heat-inactivated sirB2

    • Reaction lacking NAD+

    • Reaction with catalytic mutant (e.g., His→Tyr substitution)

  • Positive controls:

    • Well-characterized sirtuin with known activity (e.g., E. coli cobB)

    • Chemically acetylated standards for calibration

    • Time-course analysis to ensure linear reaction range

  • Specificity controls:

    • Non-acetylated substrate variants

    • Inhibitor controls (e.g., nicotinamide)

    • Substrate competition assays

Strict control implementation is crucial as early studies of sirtuins initially mischaracterized their primary enzymatic activity , highlighting the importance of comprehensive validation.

How might sirB2 research contribute to novel antimicrobial strategies?

The connection between SIR2 proteins and bacterial antiphage systems suggests several promising research directions:

  • Phage resistance engineering: Leverage sirB2 systems to develop bacteria with enhanced phage resistance

  • Anti-virulence approaches: Target sirB2-regulated processes that affect bacterial virulence

  • Phage therapy enhancement: Develop inhibitors of sirB2 to potentially increase phage infection efficiency

  • Biofilm modification: Investigate sirB2's role in biofilm formation and maintenance

Future investigation into whether sirB2 plays roles similar to the human SIR2 homolog that mediates antiphage immunity could reveal novel antimicrobial applications .

What emerging technologies will advance sirB2 functional characterization?

Cutting-edge approaches for future sirB2 research include:

  • Cryo-EM structural analysis: Obtain high-resolution structures of sirB2 alone and in complexes

  • Time-resolved enzymatic assays: Track reaction intermediates using rapid kinetic methods

  • Single-molecule studies: Observe sirB2 activity at the individual molecule level

  • Systems biology approaches: Integrate multi-omics data to place sirB2 in broader cellular networks

  • CRISPR-based screens: Identify genetic interactions and functional pathways

These approaches should build upon the established techniques used in sirtuin research, such as the HMMER-based homology detection methods that have successfully identified over 57,000 potential SIR2 family proteins across diverse species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.