Recombinant Protein spdB (spdB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Proteins

Recombinant proteins are proteins produced by cells engineered with a specific gene, serving as a vital tool in scientific research, diagnostics, and therapeutics . These proteins can have the same amino acid sequence as naturally occurring proteins or be modified for improved properties such as solubility or production yield .

Production of Recombinant Proteins

The production of recombinant proteins involves several steps:

  • Generation of Recombinant DNA: This is achieved through molecular cloning or PCR (Polymerase Chain Reaction) .

  • Expression Systems: Once the recombinant DNA is prepared, it is introduced into a host expression system such as E. coli, yeast, or mammalian cells for protein production .

Applications of Recombinant Proteins

Recombinant proteins have numerous applications:

  • Therapeutics: Used in treating conditions like cancer, autoimmune diseases, and genetic disorders .

  • Research Tools: Employed in cell culture supplements, disease modeling, and drug discovery .

  • Diagnostic Antigens: Used for immunization and antibody production .

Data Tables

Since there is no specific data available for "Recombinant Protein spdB (spdB)", here is a general table summarizing types of recombinant proteins and their applications:

Type of Recombinant ProteinApplications
ChemokinesResearch, Therapeutics
InterferonsTherapeutics, Research
Colony Stimulating FactorsTherapeutics, Research
Growth FactorsTherapeutics, Research
EnzymesDiagnostics, Therapeutics
Recombinant AntibodiesDiagnostics, Therapeutics

References

  1. Crown Bioscience Blog: Introduction to Recombinant Proteins

  2. PJMONLINE: A Comparative Study on the Activity and Antigenicity of Truncated Streptokinase

  3. PMC: Analysis of Multiple Compound–Protein Interactions

  4. Thermo Fisher Scientific: Recombinant Protein Information

  5. PMC: SPSED: A Signal Peptide Secretion Efficiency Database

  6. PMC: Impact of Structural Biologists and the Protein Data Bank

  7. Evitria: Recombinant Protein - Definition, Examples & Production

  8. PMC: SPdb – a Signal Peptide Database

  9. PMC: Recent Contributions of Structure-Based Drug Design

  10. Enzo: Why Do We Need Recombinant Proteins?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
spdB; Protein SpdB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Streptomyces lividans
Target Names
spdB
Target Protein Sequence
MEKKRSMTAAPAVAMTAVSMVLTVVVIVMWLGEAMPWAVALVVGLGLDGGWLATLAYERR LAARGDHSRAITGVGWGFGAVATGVLVAHALGEESAGAWLAVAWLPLAAKALWLVHGLWE RTALTPTALDQIRDIQQDARDRAAVARAQLRAEAGTEVTRLEAVTGAGARVARVQAETAG ELASAWSTLEEAREGEGTARALTCVTSRVTPTSPPSWRLPVWGPTEPVPAAIEGSADVVP LSNEEIDGIMSGLVDSGSYRVAAGRFRDMGYSAGEARLQASWRRVTREVAA
Uniprot No.

Target Background

Function
Involved in plasmid transfer.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.