Recombinant Protein ST7 homolog (CBG06227)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CBG06227; Protein ST7 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-536
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
CBG06227
Target Protein Sequence
MACSWTFLWLLWIAMVAVLLFFLRGPLKISESLESVSATSYFNNLTPKFYVALTGTSSLV SGIILIFEWWYFKNNAGVEQGEDEGSDNEESIDNPKTVPECKVWRNPMALFRAAEYNRFR KETNSEPLTYYDMNLSAQDHQSLFMCDEDQGRAEYEIMQVAWRERESEQRIQTARTALAI NSECASALVLLAEEDTETVAQAENVLRRALRAIENTLSTYSNNQIASYGQNGDTVRKRDL TIQTYIKRRLAMCARKQGRLREAIKGFRDLSREQSLSTLLSVQDNLIEACLEVQAYADVQ NLLVRYDGYGTSCSYDQREPRSAAMSYTSALLKVRAVAENFRCPSESSVRRGLSSAEQTA IEALTRAMEFNPHVPPYLLEIRAMIMPPEHFLKRGDSEALAYAFFHIQHWKRIDGALQLL SIVWKDFVPKVNKDTHAFSSQLESADKELLPAWHEQSAFPQTESTLGMLIQTFACLAICI LAVLSQQVPSSYGEMLRQIVTSGVQMYENSMNTFSQWAPNNIIPYLASKPVSVPEI
Uniprot No.

Target Background

Database Links

KEGG: cbr:CBG06227

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the ST7 protein and how does it relate to CBG06227?

ST7 (Suppressor of Tumorigenicity 7) is a tumor suppressor gene, originally identified on human chromosome 7q31 where it clusters with the WNT2 gene. ST7 homologs exist across multiple species, with varying degrees of sequence conservation. CBG06227 represents a specific homolog of the ST7 protein. The human ST7 protein contains multiple conserved domains, including three ST7R-homologous domains (S7H1, S7H2, and S7H3) that are preserved across species variants . These domains are critical for the protein's tumor suppressor functions. Homologs like CBG06227 share significant sequence identity with human ST7, allowing researchers to use model organisms for studying ST7 function.

What are the key structural features of ST7 homologs?

ST7 homologs contain several conserved structural features that are important for their function. Based on the analysis of various ST7 proteins, these include:

  • Leucine zipper domains (unique to certain homologs like ST7R)

  • Tyrosine-phosphorylation sites (with Tyr268 and Tyr441 highly conserved across species)

  • Three ST7-homologous domains (S7H1, S7H2, and S7H3)

The full-length sheep ST7 protein, for example, consists of 585 amino acids with specific sequence features that contribute to its function. The protein sequence includes multiple hydrophobic regions and potential membrane-spanning domains, as evidenced by the AA sequence: MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDDISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKGHLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKAMIDIFCSAELRDWNCESIFMRVEDELEIPPAPQSQHFQN .

What expression systems are most effective for producing recombinant ST7 homologs?

For ST7 homologs, multiple expression systems have been documented:

  • E. coli expression systems: Most commonly used for basic research applications, providing high yields of protein. The sheep ST7 protein, for example, has been successfully expressed in E. coli with an N-terminal His tag .

  • Yeast expression systems: Useful when post-translational modifications are important.

  • Baculovirus expression systems: Appropriate for larger, more complex proteins requiring eukaryotic processing.

  • Mammalian cell expression systems: Ideal when native folding and mammalian-specific post-translational modifications are critical .

The zebrafish ST7 homolog has been expressed using various host systems including E. coli, yeast, baculovirus, and mammalian cells, with the specific host determined during the manufacturing process based on protein stability and functional requirements .

How can I optimize the soluble expression of recombinant ST7 homologs?

Optimizing soluble expression of recombinant ST7 homologs requires a multifactorial approach. Using experimental design methodologies rather than univariate optimization can lead to significantly improved results. Key variables to consider include:

  • Expression temperature: Lower temperatures (15-25°C) often increase soluble protein yield by slowing protein synthesis and improving folding.

  • Induction parameters: The concentration of inducer (e.g., IPTG for pET systems) and timing of induction significantly impact soluble protein yields. For some recombinant proteins, induction times between 4-6 hours have been shown to provide optimal productivity, with longer induction times potentially decreasing yields .

  • Media composition: Enriched media formulations can improve protein folding and solubility.

  • Co-expression with chaperones: Molecular chaperones can assist with proper protein folding.

A statistically-designed experimental approach using factorial designs is recommended over traditional one-variable-at-a-time methods. This multivariant approach allows for:

  • Analysis of interactions between variables

  • Characterization of experimental error

  • Comparison of variable effects when normalized

  • Gathering high-quality information with fewer experiments

Using this methodology has enabled researchers to achieve high levels (250 mg/L) of soluble expression of functional recombinant proteins in E. coli, which contributes to reduced operational costs .

What purification strategies yield the highest purity of recombinant ST7 homologs?

Purification of recombinant ST7 homologs typically employs a multi-step approach to achieve high purity while maintaining protein functionality. The strategy should be tailored to the specific expression system and tag configuration used.

For His-tagged ST7 homologs, the following purification workflow is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices to capture the His-tagged protein.

  • Intermediate purification: Ion exchange chromatography based on the theoretical pI of the ST7 homolog.

  • Polishing step: Size exclusion chromatography to remove aggregates and achieve final purity.

Using this approach, researchers have achieved ≥85% purity for zebrafish ST7 homolog as determined by SDS-PAGE , and >90% purity for sheep ST7 protein .

Key considerations during purification include:

  • Buffer composition: Maintain protein stability and solubility

  • Addition of protease inhibitors: Prevent degradation

  • Temperature control: Minimize protein denaturation

  • Elution conditions: Optimize to maintain protein activity

What are the recommended storage conditions for recombinant ST7 homologs?

Proper storage of recombinant ST7 homologs is crucial for maintaining their structural integrity and biological activity. Based on experimental data, the following storage recommendations should be followed:

  • Long-term storage: Store at -20°C or -80°C in appropriate buffer conditions .

  • Working aliquots: Store at 4°C for up to one week .

  • Lyophilization: For extended stability, lyophilized preparations with cryoprotectants like trehalose (6%) have proven effective .

  • Reconstitution: When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL, and consider adding glycerol (5-50% final concentration) for aliquots intended for long-term storage .

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity .

For the sheep ST7 protein specifically, storage in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been shown to maintain protein stability .

How can I assess the functional activity of recombinant ST7 homologs?

Assessing the functional activity of recombinant ST7 homologs requires specific assays tailored to their biological functions. Since ST7 is a tumor suppressor, multiple approaches can be employed:

  • Cell-based assays:

    • Growth suppression assays using cancer cell lines

    • Colony formation assays to assess anchorage-independent growth inhibition

    • Cell migration and invasion assays to evaluate metastatic potential

  • Biochemical assays:

    • Protein-protein interaction studies with known binding partners

    • Phosphorylation status assessment of conserved tyrosine residues (particularly Tyr268 and Tyr441)

    • DNA binding assays if transcriptional regulation is suspected

  • Pathway analysis:

    • Evaluation of effects on the WNT-β-catenin-TCF signaling pathway, given the proximity of ST7 to WNT2 genes

    • Assessment of downstream target gene expression

  • Structural verification:

    • Circular dichroism to confirm proper folding

    • Limited proteolysis to assess domain integrity

When validating recombinant ST7 homolog activity, it's essential to include appropriate positive and negative controls and compare the activity to established benchmarks for the specific homolog being studied.

How do ST7 homologs interact with the WNT signaling pathway?

The interaction between ST7 homologs and the WNT signaling pathway represents a significant area of research in tumor biology. The genomic organization of ST7 and WNT genes provides important clues about their functional relationship:

  • Genomic clustering: ST7 is clustered with the WNT2 gene on human chromosome 7q31, while the ST7 homolog ST7R (ST7-like) is clustered with WNT2B on chromosome 1p13. These gene clusters are arranged in a tail-to-tail manner with intervals of less than 5.0-kb .

  • Evolutionary significance: The ST7R-WNT2B and ST7-WNT2 gene clusters likely arose from duplication of an ancestral gene cluster, suggesting functional conservation .

  • Signaling interactions: WNT2 and WNT2B isoform 2 (WNT2B2) function as positive regulators of the WNT-β-catenin-TCF signaling pathway . The proximity of ST7 and ST7R to these genes suggests potential regulatory relationships.

Research indicates that ST7 homologs may function as negative regulators of WNT signaling, possibly counterbalancing the positive regulatory effects of WNT2 or WNT2B2. This interaction could be central to their tumor suppressor function, as hyperactivation of WNT signaling is a hallmark of many cancers.

Future research directions should explore whether ST7 homologs directly interact with WNT proteins or modulate WNT signaling through indirect mechanisms such as transcriptional regulation or protein stabilization.

What are the differences in function between ST7 and its homolog ST7R (ST7L)?

ST7 and its homolog ST7R (also known as ST7L or ST7-like) share significant structural similarities but also exhibit distinct functional characteristics:

FeatureST7ST7R (ST7L)
Chromosomal location7q311p13
Associated WNT geneWNT2WNT2B
Protein lengthVariable by species (585aa in sheep)575aa (human)
Unique domainsNone reportedLeucine zipper domain
Conserved phosphorylation sitesPresentPresent (Tyr268 and Tyr441)
Homologous domainsS7H1, S7H2, S7H3S7H1, S7H2, S7H3
Alternative splicingPresentFour isoforms due to alternative splicing
Associated cancer typesVariousBreast cancer, germ cell tumors, squamous cell carcinoma, non-small cell lung cancer, GIST, meningioma, melanoma, acute megakaryoblastic leukemia, Kaposi's sarcoma

The leucine zipper domain unique to ST7R suggests potential protein-protein interactions or DNA-binding capabilities not present in ST7 . The differential association with various cancer types may indicate tissue-specific functions or regulatory mechanisms.

The existence of four ST7R isoforms resulting from alternative splicing adds another layer of functional complexity, potentially allowing for context-dependent roles in different tissues or cellular states.

What is the role of ST7 homologs in different types of cancer?

ST7 homologs have been implicated in various cancer types, functioning primarily as tumor suppressors. Their involvement varies by cancer type and specific homolog:

  • ST7: Originally identified as a tumor suppressor in the 7q31 region, which is frequently deleted in various cancers. Loss of ST7 function has been associated with:

    • Prostate cancer

    • Colorectal cancer

    • Breast cancer

    • Ovarian cancer

  • ST7R (ST7L): Associated with chromosomal region 1p13, which shows allelic loss or rearrangements in multiple cancer types :

    • Breast cancer

    • Germ cell tumors

    • Squamous cell carcinoma of head and neck

    • Non-small cell lung cancer

    • Gastrointestinal stromal/smooth muscle tumors (GIST)

    • Meningioma

    • Melanoma

    • Acute megakaryoblastic leukemia (M7)

    • Kaposi's sarcoma

The mechanism of tumor suppression may involve modulation of the WNT signaling pathway, given the genomic proximity of ST7 and ST7R to WNT2 and WNT2B genes, respectively . Disruption of this regulation through deletion, mutation, or epigenetic silencing of ST7 homologs could contribute to aberrant WNT signaling and subsequent tumorigenesis.

Future research should focus on elucidating the specific molecular mechanisms by which ST7 homologs suppress tumor growth in different cellular contexts, potentially leading to novel therapeutic approaches targeting these pathways.

How can I improve the solubility of recombinant ST7 homologs in E. coli expression systems?

Improving the solubility of recombinant ST7 homologs in E. coli often requires a systematic approach addressing multiple factors. Based on experimental design methodologies for recombinant protein expression, consider the following strategies:

  • Optimization of expression conditions:

    • Temperature: Lower expression temperatures (15-20°C) can significantly improve solubility by slowing protein synthesis and allowing proper folding

    • Induction parameters: Adjust IPTG concentration (0.01-1.0 mM) and timing; for many proteins, induction times between 4-6 hours provide optimal productivity

    • Culture density at induction: Inducing at mid-log phase (OD600 = 0.6-0.8) often yields better soluble protein

  • Buffer and media composition:

    • Use enriched media formulations with metabolic precursors

    • Add osmolytes (e.g., sorbitol, glycine betaine) to stabilize protein folding

    • Supplement with cofactors that might be required for proper folding

  • Protein engineering approaches:

    • Express as fusion proteins with solubility enhancers (e.g., MBP, SUMO, thioredoxin)

    • Consider domain-based expression if full-length protein is challenging

    • Site-directed mutagenesis of problematic residues that might contribute to aggregation

  • Co-expression strategies:

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Express in specialized E. coli strains designed for difficult proteins (e.g., Rosetta, Origami)

Using multivariant statistical experimental design approaches rather than traditional one-variable-at-a-time methods will allow you to efficiently identify optimal conditions while accounting for interactions between variables . This approach has enabled researchers to achieve high levels (250 mg/L) of soluble expression for other challenging proteins.

What are the potential causes of activity loss in purified ST7 homologs?

Activity loss in purified ST7 homologs can occur due to various factors throughout the expression, purification, and storage processes. Understanding these factors is essential for maintaining functional protein:

  • Expression-related factors:

    • Improper folding during expression leading to inactive conformations

    • Formation of inclusion bodies requiring refolding procedures that may not restore full activity

    • Lack of essential post-translational modifications if expressed in prokaryotic systems

  • Purification-related factors:

    • Harsh elution conditions (e.g., low pH, high imidazole) causing partial denaturation

    • Protein aggregation during concentration steps

    • Oxidation of critical cysteine residues

    • Proteolytic degradation during purification

  • Storage-related factors:

    • Repeated freeze-thaw cycles, which should be avoided

    • Inappropriate buffer conditions affecting protein stability

    • Protein adsorption to storage container surfaces

    • Lack of stabilizing agents in storage buffers

  • Handling-related factors:

    • Temperature fluctuations during handling

    • Mechanical stress during pipetting or mixing

    • Exposure to proteases or contaminants

To minimize activity loss, implement the following measures:

  • Include protease inhibitors during purification

  • Add stabilizing agents (e.g., glycerol, trehalose) to storage buffers

  • Store at appropriate temperatures (-20°C/-80°C for long-term, 4°C for working aliquots)

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • Consider adding reducing agents if the protein contains critical cysteine residues

For sheep ST7 specifically, storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been shown to maintain stability .

What emerging technologies can advance ST7 homolog research?

Several cutting-edge technologies are poised to significantly advance our understanding of ST7 homologs and their functions:

  • CRISPR-Cas9 genome editing:

    • Creation of precise ST7 homolog knockout or knock-in models in various cell lines

    • Introduction of specific mutations identified in cancer samples

    • Development of reporter systems for studying ST7 regulation

  • Cryo-electron microscopy:

    • Determination of high-resolution structures of ST7 homologs

    • Visualization of protein-protein interactions with binding partners

    • Structural analysis of complexes involved in WNT signaling

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell type-specific functions of ST7 homologs

    • Single-cell proteomics to track ST7 expression and modifications

    • Spatial transcriptomics to understand ST7 expression in tissue context

  • Protein interaction mapping:

    • Proximity labeling methods (BioID, APEX) to identify novel interaction partners

    • Hydrogen-deuterium exchange mass spectrometry for dynamic interaction studies

    • Interactome mapping in different cellular contexts

  • Computational approaches:

    • Machine learning for prediction of ST7 functions based on sequence features

    • Molecular dynamics simulations to understand protein dynamics

    • Systems biology approaches to place ST7 in broader signaling networks

These technologies, particularly when used in combination, will enable researchers to address fundamental questions about ST7 homolog function, regulation, and potential therapeutic targeting in cancer.

How might therapeutic strategies targeting ST7 pathways be developed?

Developing therapeutic strategies targeting ST7 pathways represents an emerging frontier in cancer research. Several approaches show promise:

  • Gene therapy approaches:

    • Restoration of ST7 or ST7R expression in cancers with gene deletion or silencing

    • CRISPR-based approaches to correct mutations or enhance expression

    • Viral vector delivery systems for targeted tumor expression

  • Small molecule modulators:

    • Compounds that enhance remaining ST7 activity in partially deficient tumors

    • Inhibitors targeting negative regulators of ST7 function

    • Molecules that mimic ST7's inhibitory effect on WNT signaling

  • Peptide-based therapeutics:

    • Peptides derived from functional domains of ST7 homologs

    • Cell-penetrating peptides delivering ST7-derived sequences

    • Stapled peptides for enhanced stability and cellular uptake

  • Targeted protein degradation:

    • PROTACs (Proteolysis targeting chimeras) targeting proteins normally regulated by ST7

    • Molecular glues to promote degradation of oncogenic factors normally suppressed by ST7

  • Combinatorial approaches:

    • Combining ST7 pathway modulation with existing WNT pathway inhibitors

    • Sequential targeting of multiple nodes in ST7-regulated pathways

    • Personalized approaches based on specific ST7 alterations in individual tumors

The diversity of cancer types associated with ST7R alterations—including breast cancer, germ cell tumors, various carcinomas, GIST, meningioma, melanoma, and leukemia —suggests that therapies targeting this pathway could have broad applications across multiple cancer types.

Development of such therapies will require deeper understanding of the precise molecular mechanisms by which ST7 homologs suppress tumor growth and how these mechanisms vary across different tissue contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.