Recombinant Protein tlpB (tlpB)

Shipped with Ice Packs
In Stock

Description

Definition and Contextual Clarification

  • A nomenclature overlap with other TLP proteins (e.g., human TBP-like protein TLP , plant TLPs , or Plasmodium TRAP-like proteins ).

  • A focus on non-recombinant studies of TlpB in H. pylori.

Related Recombinant TLP Proteins

While tlpB-specific data is absent, insights can be drawn from recombinant TLP analogs:

Human TBP-like Protein TLP

  • Source: Expressed in E. coli as a full-length protein (1–186 aa) .

  • Function: Part of a transcription system regulating ribosomal protein genes and NF1 expression .

  • Purity/Activity: >90% purity, validated for SDS-PAGE and mass spectrometry .

Plant TLPs

  • Structural Features:

    • Size: 16–26 kDa, with 16 cysteines forming 8 disulfide bonds .

    • pI Range: 3.4–12, indicating diverse charge properties .

  • Applications: Antifungal activity studies via recombinant production in inclusion bodies .

Potential Research Directions for Recombinant tlpB

Given the absence of direct data, hypothetical approaches for studying tlpB are outlined:

Research AspectMethodologyExpected Outcomes
Structural AnalysisX-ray crystallography/NMR of recombinant tlpBIdentification of domains critical for chemotaxis (e.g., transmembrane regions) .
Functional StudiesIn vitro binding assays with ligands (e.g., AI-2 metabolites) Quantification of ligand affinity (e.g., K<sub>d</sub> values).
Therapeutic PotentialHigh-throughput screening for inhibitors targeting tlpB-mediated taxisIdentification of compounds disrupting H. pylori colonization .

Critical Gaps in Literature

  1. Recombinant Production: No methodologies for tlpB expression in heterologous systems (e.g., E. coli, yeast).

  2. Biological Activity: Absence of data on purified recombinant tlpB’s role in energy taxis or pH sensing .

  3. Protein-Protein Interactions: Limited studies on tlpB interactions with downstream signaling components (e.g., Che proteins).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any preferences in your order notes, and we will prepare the protein accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
tlpB; Protein TlpB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Flavobacterium psychrophilum
Target Names
tlpB
Target Protein Sequence
MEKVKSSYLPYTIRILISFLFIISAIAKMYPSPYFAISTFEVKQLYPLGFSEIIAPWFSR ILIGIELALGILILQNNFLRKLIIPITILLLAVFVGHLSYVTFLSGGNTGNCGCFGELIP MTPIQAIIKNIIAIFLLVYLFFLLSKTNDKNNFYVVIGITLATIISLFLLAPIKKNTNDF TISPIENTLIDSTKNEIIAPILKDSVITTVKVDSVKKAIPTKIEEVISTTEPTKHKSGYA KLFPKIDTGRKTLCFFVPGCDHCRKAAKELTELKQKNANFPEILIIFMNEEVDLIPDFFK ETGAEYPYKIIEIIPFWNALGTGKDTPGVKYIWNGNTYKYYNGITDNKFNPIDYQALINK PFSELKK
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is tlpB and what is its role in Helicobacter pylori?

tlpB is an acid-sensing chemoreceptor found in the gastric pathogen Helicobacter pylori. It belongs to the class of methyl-accepting chemotaxis (MCP) proteins that bacteria use to sense chemical cues in the environment and transduce signals to regulate their swimming behavior. Genetic analysis has demonstrated that tlpB is responsible for sensing several environmental cues, including changes in pH and the presence of autoinducer-2 . This pH sensing ability is crucial for H. pylori's survival in the highly acidic environment of the stomach.

The periplasmic sensing domain accounts for approximately one-third of the total amino acids of tlpB, and structural studies have revealed that this domain contains a Per-ARNT-Sim (PAS) fold, which is a universal signaling module. Importantly, tlpB is the first bacterial chemoreceptor of known function shown by crystallography to contain an extracellular PAS domain .

How is recombinant tlpB typically expressed and purified for research purposes?

For academic research, recombinant tlpB is typically expressed as a shortened construct focusing on the periplasmic domain. In published studies, researchers have expressed the periplasmic portion of tlpB from H. pylori strain SS1, specifically residues 33-211 (referred to as TlpBpp), in Escherichia coli expression systems .

The typical expression and purification methodology includes:

  • Cloning the coding sequence for residues 33-211 of tlpB into an appropriate expression vector

  • Transforming the construct into E. coli

  • Inducing protein expression under optimized conditions

  • Cell lysis to release the expressed protein

  • Purification using chromatographic techniques

The search results indicate that the purified TlpBpp crystallized under multiple conditions, suggesting that the recombinant protein maintains its native folding when expressed in E. coli . Unlike some other recombinant proteins that require special conditions, TlpBpp appears to be amenable to standard bacterial expression systems.

What structural features characterize the tlpB protein?

The crystal structure of the periplasmic domain of tlpB (TlpBpp) has been solved at high resolution (1.38Å), revealing several key structural features:

The structure resembles that of two unpublished structures of periplasmic domains of putative MCPs from Vibrio cholerae and Vibrio parahaemolyticus, suggesting evolutionary conservation of this structural arrangement among bacterial chemoreceptors .

How does urea binding affect the function and stability of tlpB?

Urea binding plays a critical role in both the function and stability of the tlpB protein:

  • Urea is bound with extremely high affinity and specificity to the PAS domain of tlpB

  • Researchers found that urea co-purifies with TlpBpp in roughly 1:1 molar stoichiometry, even though it was not added to any of the crystallization or protein purification buffers

  • Attempts to prepare apo-TlpBpp (without urea) resulted in protein precipitation, suggesting that urea plays an important role in the stability of the protein fold

Thermal denaturation studies using circular dichroism showed that TlpBpp exhibits two structural transitions during thermal unfolding:

  • A fully reversible transition with an apparent Tm of about 20°C

  • A second, irreversible transition occurring at about 50°C

Addition of exogenous urea increases the melting temperature of the first transition, further supporting the stabilizing role of urea . This unique relationship between urea binding and protein stability suggests that urea functions as a cofactor rather than just a ligand, playing an essential role in the pH-sensing mechanism of tlpB.

What is the relationship between tlpB and pH sensing in H. pylori?

The relationship between tlpB and pH sensing in H. pylori appears to be mediated through the pH-dependent binding of urea in the PAS domain. Key aspects of this relationship include:

  • Circular dichroism (CD) spectroscopy studies show that TlpBpp exhibits the most stable α-helical structure at pH 4.5, which is near the middle of the pH range experienced in the stomach environment

  • The protein becomes less folded at more neutral pH values and mostly unfolded at pH less than 3.0

  • The urea binding site includes an aspartate group (Asp114), which is proposed to be the key titratable residue responsible for pH sensing

Researchers propose that protonation events at Asp114, affected by changes in pH, dictate the stability of TlpB through urea binding . Notably, pH 4.5 is close to the unperturbed pKa (4.0) of the Asp114 side chain, suggesting this residue plays a crucial role in the pH-dependent conformational changes that allow H. pylori to detect and respond to the acidic environment of the stomach .

What are the optimal conditions for expressing and purifying functional recombinant tlpB?

Based on published research methodologies, several key considerations should be made when expressing and purifying functional recombinant tlpB:

ParameterOptimal ConditionRationale
Expression SystemE. coliSuccessfully used for periplasmic domain (residues 33-211)
Construct DesignPeriplasmic domain (TlpBpp)Contains functional PAS domain for urea binding and pH sensing
Buffer pH~4.5Protein shows maximum stability at this pH
TemperatureBelow 20°CFirst thermal transition occurs at ~20°C
AdditivesUreaCo-purifies with protein and enhances stability

For researchers working with the full-length transmembrane protein, additional considerations include:

  • Use of appropriate detergents or membrane mimetics

  • Lower expression temperatures to aid proper membrane insertion

  • Inclusion of protease inhibitors to prevent degradation of flexible regions

Quality control assessment should include circular dichroism to verify proper α-helical content and colorimetric urea assays to confirm proper cofactor binding at a 1:1 stoichiometry .

What methodologies are effective for studying the pH-dependent conformational changes in tlpB?

Based on published approaches, several complementary methods can be employed to study pH-dependent conformational changes in tlpB:

  • Circular Dichroism (CD) Spectroscopy:

    • Record CD spectra (260-200nm) in buffers ranging from pH 2.5 to 7.8

    • Monitor the minima near 220nm to quantify α-helical content

    • Compare spectra across the pH range to identify transitions

  • Thermal Stability Analysis:

    • Conduct CD thermal denaturation assays at different pH values

    • Monitor α-helical content (at 220nm) while slowly heating the protein from ~1.2°C to 86°C

    • Determine apparent melting temperatures (Tm) at each pH value

  • Site-Directed Mutagenesis:

    • Create mutations at Asp114 and other potential pH-sensing residues

    • Compare pH-dependent structural changes between wild-type and mutant proteins

    • Mutations that alter the pKa (D114E, D114N) can provide mechanistic insights

  • Structural Studies:

    • X-ray crystallography at different pH values

    • NMR studies to identify residues with altered chemical shifts at different pH values

A systematic application of these methodologies, coupled with functional assays in H. pylori, would provide comprehensive insights into how pH-dependent conformational changes in tlpB contribute to acid sensing and bacterial chemotaxis.

How can researchers investigate the urea binding mechanism of tlpB?

Several methodological approaches can be employed to investigate the urea binding mechanism:

MethodApplicationExpected Information
Colorimetric AssaysQuantify bound ureaStoichiometry of urea binding
Isothermal Titration CalorimetryMeasure binding thermodynamicsBinding affinity, enthalpy, entropy changes
Structural AnalysisX-ray crystallography with bound ureaPrecise binding interactions
MutagenesisAlter binding pocket residuesIdentify critical residues for binding
Thermal StabilityCD with varying urea concentrationsEffect of urea on protein stability
Competition AssaysTest urea analogsBinding specificity

The search results indicate that the colorimetric assay for urea detection is specific, as other urea-like molecules do not react with the detection reagents . This assay revealed that urea is present in roughly 1:1 molar stoichiometry to TlpBpp .

For studies investigating the pH-dependence of urea binding, researchers should consider combining these approaches with pH titrations to elucidate how protonation of Asp114 affects urea binding affinity and protein stability.

What mutagenesis strategies can be used to investigate the functional domains of tlpB?

Site-directed mutagenesis represents a powerful approach to dissect the functional domains of tlpB. Based on the structural and biochemical information available, several targeted strategies can be employed:

  • Urea Binding Site Mutations:

    • Asp114 mutations (D114N, D114E) to alter pH sensitivity

    • Mutations of other residues directly contacting urea

    • Predicted effects: altered pH sensitivity, changed urea binding affinity

  • PAS Domain Interface Mutations:

    • Target residues at the dimeric interface

    • Predicted effects: disrupted dimerization, altered signal transduction

  • Hinge Region Mutations:

    • Identify and mutate potential flexible regions

    • Predicted effects: altered conformational changes, disrupted signal propagation

For each mutation, researchers should perform:

  • Protein stability assessment (CD spectroscopy)

  • Urea binding measurements

  • pH-dependent conformational change analysis

  • Functional chemotaxis assays in H. pylori

A comprehensive mutagenesis study would provide a structure-function map of tlpB, identifying critical residues involved in pH sensing, urea binding, and signal transduction.

What are the challenges and strategies for structural studies of full-length tlpB?

While researchers have successfully crystallized the periplasmic domain of tlpB , several challenges remain for structural studies of the full-length protein:

ChallengeStrategy
Membrane protein crystallizationUse lipidic cubic phase crystallization techniques
Protein stabilityInclude urea during purification; optimize detergent conditions
Conformational heterogeneityUse antibody fragments or nanobodies to stabilize specific conformations
Low expression yieldsOptimize codon usage; use specialized expression systems

Alternative structural approaches to consider include:

  • Cryo-electron microscopy (cryo-EM)

  • Single-particle analysis for the full-length receptor

  • Solid-state NMR for membrane-embedded domains

  • Integrative structural biology combining multiple techniques

The divide-and-conquer approach that yielded the periplasmic domain structure could be extended to other domains of the protein, potentially providing insights into how structural changes propagate through the full receptor.

How can researchers investigate the integration of tlpB into the broader chemotaxis pathway?

As a methyl-accepting chemotaxis protein (MCP), tlpB likely interacts with the core chemotaxis machinery. Several approaches can be used to investigate these interactions:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify interaction partners

    • Bacterial two-hybrid assays to confirm direct interactions

    • Crosslinking studies to capture transient interactions

  • Localization Studies:

    • Fluorescence microscopy with tagged components

    • Immunogold electron microscopy for higher resolution

  • Functional Pathway Analysis:

    • Knockout studies of various chemotaxis components

    • Complementation assays with mutated proteins

    • Chemotaxis assays in pH gradients

  • Integration of Multiple Signals:

    • Studies to understand how pH sensing integrates with autoinducer-2 sensing

    • Analysis of receptor clustering and potential cross-talk

Understanding how the pH-sensing function of tlpB connects to the broader chemotaxis machinery would provide insights into how H. pylori navigates the harsh stomach environment and contributes to its pathogenicity.

What approaches can be used to study tlpB in its native membrane environment?

Studying membrane proteins like tlpB in their native environment requires specialized approaches:

  • Fluorescence-Based Techniques:

    • Fluorescent protein fusions to study localization

    • FRET to study protein-protein interactions

    • Single-molecule tracking for receptor dynamics

  • In Situ Structural Approaches:

    • Cryo-electron tomography of bacterial cells

    • Subtomogram averaging for higher resolution

  • Native Membrane Systems:

    • Isolation of native membranes containing tlpB

    • Reconstitution in proteoliposomes

    • Nanodiscs or SMALPs to extract with surrounding lipids

  • Functional Assays:

    • pH taxis assays using wild-type or mutant H. pylori

    • Microfluidic devices to create controlled pH gradients

    • Correlation of receptor signaling with bacterial behavior

These approaches provide complementary information about how tlpB functions in its native context and how structural changes observed in vitro translate to functional outcomes in the living bacterial cell.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.