Recombinant Protein tolQ (tolQ)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Protein TolQ (TolQ)

TolQ is an integral cytoplasmic membrane protein in Escherichia coli consisting of 230 amino acids . It is essential for maintaining the integrity of the bacterial envelope, facilitating the import of filamentous bacteriophages and group A colicins . Research indicates that TolQ is a polytopic protein, featuring three membrane-spanning regions . The protein's structure includes an amino-terminal tail of 19 residues located in the periplasm, and a short periplasmic loop of 17 amino acids separating the second and third membrane-spanning segments .

Structure and Membrane Topology

TolQ is localized in the cytoplasmic membrane . Its structure includes three transmembrane domains (TMDs) and a large cytoplasmic insertion domain situated between the first and second TMDs . The amino-terminal 19 residues and a small loop in the 155 to 170 residue region are exposed in the periplasm, while the carboxy terminus and a large loop after the first transmembrane region are cytoplasmic .

Functional Significance

  • Role in Cell Division: Overexpression of TolQ can lead to cell filamentation, which is similar to the phenotype observed when cells are depleted of FtsN . This suggests that TolQ may interact with FtsN, disrupting normal cell division .

  • Maintenance of Cell Envelope Integrity: TolQ is crucial for maintaining the integrity of the bacterial envelope . Mutations in the transmembrane segments of TolQ can compromise cell envelope integrity, leading to the leakage of RNase I and the formation of outer membrane vesicles .

  • Virulence and Survival: The Tol-Pal system, which includes TolQ, plays a significant role in the virulence and survival of Gram-negative bacteria during pathogenesis, making it a potential target for antibacterial interventions . Deletion of tolQ in various bacterial species, such as Edwardsiella ictaluri, Salmonella typhimurium, and Salmonella holeraesuis, has been shown to decrease virulence .

Mechanism of Action

  • Membrane Insertion: Studies on the membrane assembly of TolQ indicate that the insertion of intact TolQ is not dependent on the Sec system but does require the membrane potential . The first membrane-spanning region can insert even without a membrane potential, while the second and third membrane-spanning regions require it .

  • Interaction with FtsN: TolQ interacts physically with FtsN, a protein involved in cell division, through domains that localize in the periplasmic space . Overexpression of TolQ can sequester FtsN, depleting it from the divisome and disrupting cell division .

  • TolQ-TolR Complex: TolQ forms a complex with TolR, which is essential for transferring proton motive force (PMF) energy to the outer membrane . The TolQ-TolR complex transitions from a symmetric pentameric pore in the apo form to a proton non-permeable stance, which involves structural rearrangements that are crucial for cell envelope organization and bacterial cell division .

Mutational Analysis

  • Effects of Mutations: Analysis of tolQ mutant strains reveals that the third transmembrane region and parts of the large cytoplasmic loop are necessary for TolQ activity . Mutations in the transmembrane segments can alter cell envelope integrity and affect the permeability of the cell envelope .

  • Specific Residue Importance: Specific residues, such as Pro190 and Glu176, are critical for the structural integrity of TolQ. Mutations at these sites can affect the folding and stability of the TolQ pentamer, potentially disrupting its function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tolQ; Z0905; ECs0772; Tol-Pal system protein TolQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
tolQ
Target Protein Sequence
MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI ELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNREL ENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAFTVSESNKG
Uniprot No.

Target Background

Function
TolQ is a component of the Tol-Pal system, crucial for outer membrane invagination during cell division and maintaining outer membrane integrity. In conjunction with TolR, it's essential for proton motive force-dependent activation of TolA and the TolA-Pal interaction.
Database Links

KEGG: ece:Z0905

STRING: 155864.Z0905

Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is TolQ and what is its biological significance?

TolQ is a cytoplasmic membrane protein in Escherichia coli that forms part of the Tol-Pal complex, which plays a crucial role in maintaining the integrity of the bacterial outer membrane and facilitating the import of group A colicins and filamentous phage DNA . From a structural perspective, TolQ is localized in the inner membrane along with TolR and TolA, while TolB is primarily periplasmic . The biological significance of TolQ extends beyond membrane integrity to cell division processes, as evident from phenotypic studies showing that TolQ overexpression results in elongated rods coupled in long chains when grown under normal salt conditions .

How does TolQ function within the Tol-Pal system?

TolQ functions as part of a heteromultimeric cytoplasmic membrane protein complex that works with TolR to couple TolA to the electrochemical gradient of the cytoplasmic membrane . In vivo cross-linking experiments have demonstrated that TolQ directly interacts with both TolR and TolA proteins . Specifically, the N-terminal domain of TolA interacts with TolQ and TolR, forming specific complexes of 65 and 71 kDa that can be identified through cross-linking techniques . These interactions are essential for energy transduction within the Tol system, which ultimately enables outer membrane processes in the Gram-negative bacterial envelope .

What phenotypic changes occur in cells with TolQ mutations or overexpression?

  • Elongated rod-shaped cells

  • Formation of long chains of coupled cells

  • Visible division defects even under normal salt conditions

  • Phenotypic similarities to cells depleted of the essential division protein FtsN

Interestingly, neither TolR nor TolA overexpression produces a similar phenotype, suggesting a unique role for TolQ in cell division .

What expression systems are most suitable for recombinant TolQ production?

For recombinant TolQ production, bacterial expression systems based on E. coli are generally preferred due to the native origin of the protein. When selecting an expression system, researchers should consider:

  • Membrane protein expression challenges: As TolQ is an inner membrane protein, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may yield better results than standard BL21(DE3) strains.

  • Fusion tag strategies: Adding fusion tags that aid in membrane protein expression and purification can improve yields. Common approaches include:

    • N-terminal His6-tags for purification

    • MBP (maltose-binding protein) fusions to enhance solubility

    • GFP fusions to monitor expression and folding

  • Induction protocols: Lower temperatures (16-25°C) and reduced inducer concentrations often improve membrane protein folding and decrease toxicity when overexpressing membrane proteins like TolQ .

What are the main challenges in obtaining properly folded recombinant TolQ?

Producing properly folded recombinant TolQ presents several challenges typical of membrane proteins:

  • Protein folding and stability: As a membrane protein, TolQ requires the hydrophobic membrane environment to fold correctly. Expression in heterologous systems may lead to misfolding or aggregation due to overloading of membrane insertion machinery .

  • Toxicity issues: Overexpression of membrane proteins often becomes toxic to host cells, limiting yield and viability of the expression system. This is particularly relevant for TolQ, as its overexpression disrupts normal cell division in native contexts .

  • Solubility considerations: Extraction of TolQ from membranes requires careful selection of detergents that maintain the protein's native conformation and activity. Different detergents should be screened for optimal solubilization and stabilization of TolQ .

  • Post-translational modifications: While bacterial proteins generally have fewer modifications than eukaryotic proteins, any native modifications essential for TolQ function must be preserved in the recombinant system .

How can researchers design true experimental studies to investigate TolQ function?

True experimental designs for investigating TolQ function should incorporate the following elements:

  • Control groups with random assignment: When testing TolQ function in cell lines or model systems, use proper control groups (such as cells with native TolQ expression levels) alongside experimental groups with manipulated TolQ levels .

  • Independent variable manipulation: Manipulate TolQ expression levels (deletion, reduced expression, overexpression) as the primary independent variable .

  • Dependent variable measurement: Clearly define measurable outcomes such as:

    • Membrane integrity (measured by permeability assays)

    • Cell division dynamics (measured by time-lapse microscopy)

    • Protein-protein interactions (measured by co-immunoprecipitation)

    • Phage or colicin sensitivity

  • Control for extraneous variables: Account for factors that might influence results, such as:

    • Growth conditions (temperature, media composition, salt concentration)

    • Expression levels of other Tol-Pal system components

    • Cell density and growth phase

The unique strength of this approach is its internal validity and ability to establish causality through treatment manipulation while controlling for extraneous variables .

What protein-protein interaction methods are most effective for studying TolQ interactions?

Based on research findings, several methods have proven effective for studying TolQ interactions:

  • In vivo cross-linking with formaldehyde: This approach has successfully identified specific TolQ-containing complexes (65 kDa and 71 kDa) in wild-type strains. When combined with immunoprecipitation using antisera against interaction partners, it can confirm direct protein associations .

  • Two-hybrid analysis: Cytoplasm-based two-hybrid analysis has shown that the amino-terminal domain of TolQ specifically associates with the periplasmic domain of FtsN in vivo, revealing unexpected interaction partners .

  • Co-immunoprecipitation experiments: After cross-linking, co-immunoprecipitation with antibodies directed against TolA has demonstrated that TolQ and TolR physically associate with TolA .

  • Fluorescent protein fusions: GFP or RFP fusions with TolQ can visualize its localization to constriction sites during cell division, although care must be taken to ensure fusion proteins retain native functionality .

How can researchers effectively test the hypothesis that TolQ overexpression sequesters FtsN?

To test the hypothesis that TolQ overexpression leads to division defects by sequestering FtsN, researchers could employ the following experimental approach:

  • Construct expression systems with:

    • Inducible TolQ overexpression

    • Inducible FtsN overexpression

    • Co-expression of both proteins at different induction levels

  • Analyze phenotypic outcomes through:

    • Microscopy to assess cell morphology and division defects

    • Quantification of chain formation and cell elongation

    • Time-lapse imaging to observe division dynamics

  • Perform protein localization studies:

    • Immunofluorescence or fluorescent protein fusions to track FtsN localization

    • Co-localization analysis of TolQ and FtsN

    • Quantification of FtsN at division sites with and without TolQ overexpression

  • Test rescue conditions:

    • Evaluate whether concomitant overexpression of FtsN rescues the TolQ-dependent phenotype, as previously observed

    • Test different ratios of TolQ:FtsN expression to determine threshold levels

This multi-faceted approach would provide strong evidence either supporting or refuting the sequestration hypothesis.

How do TolQ-TolR-TolA interactions contribute to energy transduction in the bacterial envelope?

The TolQ-TolR-TolA complex forms a crucial energy transduction system in the bacterial envelope. Based on current research:

  • TolQ and TolR form a complex similar to the ExbB-ExbD proteins of the TonB system, which harnesses the proton motive force across the cytoplasmic membrane .

  • The N-terminal domain of TolA directly interacts with both TolQ and TolR, as demonstrated by in vivo cross-linking experiments that identified specific complexes (65 kDa and 71 kDa) in wild-type strains .

  • When either TolQ or TolR is absent, these specific complexes are disrupted - both complexes are absent in tolQ strains, while only the 65-kDa complex is absent in tolR strains .

  • The energy harvested by the TolQ-TolR complex is transmitted to TolA, which spans the periplasmic space to interact with outer membrane components, including TolB and Pal .

To fully characterize this energy transduction mechanism, researchers should consider:

  • Site-directed mutagenesis of key residues in the interaction domains

  • Biophysical measurements of proton translocation during complex activity

  • Structural studies of the entire complex under different energetic states

What is the structural basis for TolQ-FtsN interaction, and how does it impact cell division?

The surprising interaction between TolQ and FtsN represents an important link between the Tol-Pal system and the bacterial divisome. Current evidence suggests:

  • The amino-terminal domain of TolQ specifically associates with the periplasmic domain of FtsN in vivo, as demonstrated by cytoplasm-based two-hybrid analysis .

  • This interaction is consistent with the native membrane topology of both proteins .

  • Overexpression of TolQ produces a division phenotype similar to that seen in cells depleted for FtsN .

  • Concurrent overexpression of FtsN rescues the TolQ-dependent division defect phenotype .

These findings support a model where overexpressed TolQ sequesters FtsN, depleting this essential protein from the divisome during Gram-negative cell division . Future research should focus on:

  • Determining the precise interacting domains between TolQ and FtsN

  • Investigating whether this interaction occurs during normal division or only under stress conditions

  • Examining if other divisome components interact with Tol-Pal proteins

How do mutations in TolQ affect outer membrane integrity and colicin/phage sensitivity?

TolQ mutations have significant effects on outer membrane integrity and susceptibility to external agents:

  • Mutations in TolQ lead to compromised outer membrane integrity, resulting in:

    • Increased permeability to harmful compounds

    • Release of periplasmic contents

    • Formation of outer membrane vesicles

    • Hypersensitivity to detergents and bile salts

  • TolQ mutants demonstrate altered sensitivity patterns:

    • Tolerance (resistance) to certain colicins that typically kill wild-type cells

    • Resistance to filamentous phage infection

    • Changed susceptibility to certain antibiotics that target the cell envelope

  • These phenotypes highlight the dual role of TolQ in:

    • Maintaining envelope integrity through the Tol-Pal system

    • Facilitating import of group A colicins and filamentous phage DNA

For comprehensive characterization of TolQ mutation effects, researchers should employ assays measuring:

  • Membrane permeability using fluorescent dyes

  • Colicin and phage sensitivity through plaque/killing assays

  • Electron microscopy to visualize envelope defects

What are effective strategies for optimizing recombinant TolQ yield and quality?

Optimizing recombinant TolQ production requires addressing several challenges specific to membrane proteins:

Optimization ParameterStrategyExpected Outcome
Expression strainUse C41(DE3), C43(DE3) or Lemo21(DE3)Reduced toxicity, higher yield
Induction conditionsLow temperature (16-20°C), reduced IPTG (0.1-0.5 mM)Improved folding, reduced aggregation
Media compositionSupplemented with glucose (0.5-1%)Tighter regulation of leaky expression
Detergent screeningTest DDM, LDAO, FC-12Identify optimal detergent for solubilization
Fusion tagsN-terminal MBP or SUMO tagsEnhanced solubility and expression
Purification approachTwo-step purification (IMAC followed by SEC)Higher purity and homogeneity
Stabilizing additivesGlycerol (10%), specific lipidsImproved stability during purification

Additionally, researchers should consider:

  • Using auto-induction media to achieve gradual protein expression

  • Adding specific metal ions if required for stability

  • Optimizing cell disruption methods to efficiently extract membrane proteins

  • Including protease inhibitors throughout the purification process

How can researchers troubleshoot failed TolQ-TolR-TolA complex formation in experimental settings?

When complex formation between TolQ, TolR, and TolA fails in experimental settings, researchers should systematically troubleshoot using this approach:

  • Verify individual protein expression and stability:

    • Confirm expression levels using western blotting with specific antibodies

    • Assess membrane localization of each component

    • Check protein stability under experimental conditions

  • Optimize cross-linking conditions for complex detection:

    • Test different cross-linker types (formaldehyde, DSP, BS3)

    • Vary cross-linker concentration and reaction time

    • Ensure proper quenching of cross-linking reactions

  • Validate antibody specificity for immunoprecipitation:

    • Use tagged versions of proteins if native antibodies are problematic

    • Confirm antibody specificity against purified proteins

    • Consider epitope accessibility in membrane-embedded proteins

  • Review buffer conditions for complex stability:

    • Test different detergents that preserve protein-protein interactions

    • Optimize salt concentration and pH

    • Add stabilizing agents (glycerol, specific lipids)

  • Examine expression ratios between components:

    • TolQ, TolR, and TolA may require specific stoichiometry

    • Test co-expression versus individual expression and mixing

    • Consider native expression levels as a guide

What controls are essential when studying TolQ overexpression phenotypes?

When investigating TolQ overexpression phenotypes, the following controls are essential for robust experimental design:

  • Expression level controls:

    • Empty vector control (same backbone, no insert)

    • Non-relevant membrane protein overexpression (similar size/topology)

    • Quantification of TolQ expression levels (western blot)

    • Dose-dependent induction to correlate expression with phenotype

  • Genetic background controls:

    • Wild-type strain with normal TolQ expression

    • TolQ deletion strain (ΔtolQ)

    • Strains with deletions in related Tol proteins (ΔtolR, ΔtolA)

    • Complementation of ΔtolQ with wild-type tolQ

  • Phenotypic controls:

    • Control for growth conditions (media, temperature, aeration)

    • Time course analysis of phenotype development

    • Microscopy controls (fixation, staining, imaging parameters)

    • Quantitative metrics for phenotype assessment

  • Rescue experiment controls:

    • FtsN overexpression alone control

    • Co-expression of TolQ with unrelated division proteins

    • Expression of TolQ mutants unable to interact with FtsN

    • Titration of FtsN expression levels against fixed TolQ levels

What novel approaches could advance our understanding of TolQ's role in bacterial cell division?

Advancing our understanding of TolQ's role in cell division will require innovative approaches:

  • Advanced microscopy techniques:

    • Super-resolution microscopy (PALM/STORM) to precisely localize TolQ during division

    • Single-molecule tracking to observe dynamic behavior of TolQ molecules

    • Correlative light-electron microscopy to link TolQ localization with ultrastructural features

  • Protein engineering approaches:

    • Split fluorescent protein systems to visualize TolQ-FtsN interactions in vivo

    • Optogenetic control of TolQ expression or activity

    • Creation of minimal TolQ domains that retain specific interactions

  • Systems biology integration:

    • Global genetic interaction screens to identify novel TolQ genetic partners

    • Quantitative proteomics to measure divisome composition changes upon TolQ perturbation

    • Mathematical modeling of Tol-Pal and divisome coordination

  • Structural biology investigations:

    • Cryo-EM structures of Tol-Pal complexes in different functional states

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • NMR studies of TolQ domains and their interactions with division proteins

How might the TolQ-FtsN interaction be leveraged for antimicrobial development?

The TolQ-FtsN interaction represents a potential target for novel antimicrobial development:

  • Targeted disruption strategies:

    • Small molecule inhibitors that block the TolQ-FtsN interaction could disrupt bacterial cell division

    • Peptide mimetics designed to compete with natural interaction surfaces

    • Allosteric modulators that affect TolQ conformation and binding properties

  • Proof-of-concept approaches:

    • High-throughput screening of compound libraries against reconstituted TolQ-FtsN interactions

    • Fragment-based drug discovery focusing on critical interaction hotspots

    • Structure-guided design of interaction inhibitors

  • Potential advantages as an antimicrobial target:

    • The Tol-Pal system is conserved across many Gram-negative bacteria

    • Cell division is an essential process for bacterial survival

    • The periplasmic location of the interaction may be more accessible to drugs than cytoplasmic targets

    • Limited homology to human proteins reduces potential toxicity

  • Combination therapy potential:

    • TolQ-FtsN inhibitors might sensitize bacteria to existing antibiotics

    • Synergistic effects with other division inhibitors

    • Potential to overcome existing resistance mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.