Recombinant Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Evolutionary Conservation and Protein Family

SecD belongs to the SecD/SecF family of proteins, specifically the SecD subfamily . This classification reflects evolutionary relationships and functional similarities among related proteins across different bacterial species. The conservation of SecD across diverse bacterial lineages underscores its fundamental importance to bacterial physiology and protein secretion mechanisms.

Interestingly, while SecD and SecF are separate proteins in many bacteria including E. coli, they can be found as a fused protein (SecDF) in some bacterial species. This fusion suggests tight functional coupling between these two components of the Sec machinery. The evolutionary pressure to maintain SecD function across bacterial species highlights its critical role in protein translocation.

Research exploring cross-species functionality has shown that expression of Vibrio alginolyticus SecD and SecF in E. coli confers sodium-dependent protein export capabilities . This finding strongly suggests that SecDF functions via cation-coupled protein translocation mechanisms, with the specific cation dependency (proton vs. sodium) potentially varying between bacterial species.

Role in Protein Translocation

The primary function of SecD is to participate in the process of protein translocation across the bacterial cytoplasmic membrane. Within the Sec protein translocase complex, SecD plays a specialized role in the later stages of translocation. While the initial steps of protein export are driven by the ATP-dependent motor protein SecA, SecD functions in conjunction with SecF to complete the translocation process using the proton motive force (PMF) .

SecD interacts with the SecYEG preprotein conducting channel, which forms the core translocation pore through which secretory proteins pass . This interaction positions SecD to assist proteins as they emerge from the channel into the periplasmic space. The SecDF complex (comprised of SecD and SecF) is thought to use the energy from the proton gradient across the membrane to facilitate the final stages of protein translocation .

The mechanism by which SecD contributes to protein translocation involves conformational changes in its periplasmic domain. The head domain of SecD is believed to capture substrate proteins as they emerge from the SecYEG channel . Subsequently, conformational changes in SecD prevent backward movement of the translocating protein and actively drive its forward movement across the membrane . This ratcheting mechanism ensures directional transport of proteins from the cytoplasm to the periplasm.

Interaction with Other Sec Components

SecD functions as part of an integrated protein translocation system, interacting with multiple components to achieve efficient protein export. Most significantly, SecD interacts directly with the SecYEG complex, which forms the core translocation channel . This interaction creates a functional interface between the channel and the SecDF complex that is essential for complete protein translocation.

The SecD and SecF proteins work together closely, often functioning as a unit referred to as the SecDF complex. This tight functional coupling is evidenced by their organization as a fused protein in some bacterial species. When reconstituted with SecE and SecY in proteoliposomes, purified SecD and SecF have been used to analyze translocation activity, though significant effects on translocation were not observed in this reconstituted system . This suggests that additional components or specific conditions may be necessary for optimal SecDF function.

The complete translocation machinery in E. coli is estimated to include approximately 500 complexes per cell . This relatively low number highlights the efficiency of the system, as these complexes must handle the export of numerous proteins required for cell growth and function. SecD's integration into this system involves precise interactions with other Sec components to ensure proper protein translocation.

Energy Requirements and Mechanism

A distinctive feature of SecD function is its utilization of the proton motive force (PMF) rather than ATP hydrolysis to drive protein translocation . While the initial stages of protein translocation are powered by the ATP-dependent activity of SecA, SecD and SecF use the energy stored in the proton gradient across the cytoplasmic membrane to complete the translocation process .

The mechanism of PMF utilization by SecDF appears to involve proton transport coupled to conformational changes in the protein. These conformational changes, particularly in the hinge region connecting the base and head domains of the periplasmic portion, are thought to drive the directional movement of substrate proteins . This coupling of proton flow to mechanical work enables SecD to apply force to translocating proteins without direct ATP consumption.

Interestingly, studies have shown that expression of Vibrio alginolyticus SecD and SecF in E. coli results in sodium-dependent rather than proton-dependent protein export . This finding strongly suggests that the SecDF complex functions through cation-coupled transport mechanisms, with the specific cation varying between bacterial species. This adaptability may reflect evolutionary adjustments to different environmental conditions encountered by various bacterial species.

Purification Strategies

The purification of recombinant SecD presents challenges common to membrane proteins, requiring specialized approaches to extract and isolate the protein while maintaining its structure and function. According to the available information, SecD purification has been accomplished through a multi-step process beginning with membrane fraction preparation .

The initial step involves differential solubilization of the membrane fraction containing overproduced SecD . This process uses detergents to selectively extract membrane proteins from the lipid bilayer, creating detergent-protein complexes that can be manipulated in aqueous solution. Following solubilization, SecD purification continues with ion-exchange chromatography, which separates proteins based on their charge characteristics .

The final purification step employs size-exclusion chromatography, which separates proteins based on their molecular size . This multi-stage chromatographic approach allows for the isolation of purified SecD protein suitable for subsequent biochemical and functional analyses. The purification strategy for SecF follows a similar pattern, though it differs in utilizing only size-exclusion chromatography rather than the combination of ion-exchange and size-exclusion techniques used for SecD .

Table 1: Purification Methods for Recombinant SecD

MethodPurpose
Differential SolubilizationExtraction from membrane fraction
Ion-exchange ChromatographySeparation based on charge properties
Size-exclusion ChromatographySeparation based on molecular size
Verification MethodsImmunoblot analysis and amino acid sequencing

Quality Control and Verification Methods

Ensuring the identity and quality of purified recombinant SecD requires rigorous analytical methods. According to the research findings, verification of recombinant SecD has been accomplished using immunoblot analysis and amino acid sequencing . These techniques confirm both the immunological identity and primary structure of the purified protein.

Immunoblot analysis (Western blotting) employs antibodies specific to SecD to detect and confirm the presence of the protein in purified samples. This approach provides a sensitive method for verifying the identity of the purified protein and can also help assess its integrity by revealing any major degradation products.

Amino acid sequencing provides definitive confirmation of protein identity by determining the sequence of amino acids in the purified protein and comparing it to the expected sequence for SecD. This technique offers high-resolution verification of recombinant protein identity and can potentially identify any modifications or truncations that might have occurred during expression or purification .

Additional quality control measures likely include assessment of protein purity using techniques such as SDS-PAGE (sodium dodecyl sulfate-polyacrylamide gel electrophoresis) and verification of proper folding through activity assays or structural analyses, though specific details of these approaches for SecD are not explicitly mentioned in the available research literature.

Functional Reconstitution Experiments

Functional studies of recombinant SecD have included reconstitution experiments aimed at recreating translocation activity in artificial systems. Researchers have created proteoliposomes containing purified SecD and SecF together with SecE and SecY to analyze translocation activity . These reconstituted systems provide controlled environments for examining the function of Sec components.

Interestingly, the research indicates that SecD and SecF did not exhibit significant effects on translocation activity in these reconstituted proteoliposome systems . This finding suggests that either additional components are required for full SecDF function, or that specific conditions or substrates not present in the experimental system are necessary to observe SecDF activity.

Quantitative Analysis in Cellular Systems

Quantitative studies of recombinant SecD have provided insights into the abundance of Sec components in bacterial cells. Research has determined the amounts of SecD and SecF in overproducing strains through densitometric analysis of stained SDS gels, and the degree of overproduction has been quantified using immunoblot analysis .

Based on these measurements, researchers have estimated the number of SecD molecules present in a normal E. coli cell . This quantitative information, combined with similar data for other Sec proteins, has led to the inference that approximately 500 translocation machinery complexes exist in a single E. coli cell . This relatively low number suggests that each translocase complex must process multiple substrate proteins to meet the cell's secretion needs.

The quantitative analysis of SecD and other Sec components provides context for understanding the stoichiometry and organization of the translocation machinery. It also offers perspective on the relative expression levels of different components and how these might influence the assembly and function of complete translocase complexes.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own adjustments.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
secD; Z0507; ECs0459; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-615
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
secD
Target Protein Sequence
MLNRYPLWKYVMLIVVIVIGLLYALPNLFGEDPAVQITGARGVAASEQTLIQVQKTLQEE KITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALNLAPATPRWLAAIHAEP MKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGIPYTTVRKENNYGLSITF RDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEAREYAVQQNINILRNRVNQ LGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNTNVDQAAAASGRVPG DSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQVNISLDSAGGNIMSNFTKDN IGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQSRLGNSFRITGINNPNEARQL SLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACLAGLLVSILFMIIFYKKFGLIAT SALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVAVDANVLINERIKEELSNGRTVQQ AIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIKGFAITTGIGVATSMFTAIVGTRAI VNLLYGGKRVKKLSI
Uniprot No.

Target Background

Function
Recombinant Protein translocase subunit SecD (secD) is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links

KEGG: ece:Z0507

STRING: 155864.Z0507

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is SecD and what is its role in protein translocation?

SecD is a component of the bacterial Sec translocon, an evolutionarily conserved multiprotein complex that facilitates the biogenesis of both secretory and membrane proteins . Together with other Sec components (SecY, SecE, SecF), it forms the machinery responsible for translocating proteins across the inner membrane in bacteria. While SecD and SecF do not exhibit significant effects on the translocation activity of proteoliposomes in isolation, they are integral parts of the complete translocation machinery . The Sec translocon primarily functions to translocate proteins in an unfolded state across the inner membrane, with the number of functional translocation machinery complexes estimated to be around 500 per Escherichia coli cell .

How is recombinant SecD typically produced for research purposes?

Recombinant SecD protein can be efficiently overproduced using recombinant DNA technology. The standard approach involves constructing expression vectors containing the secD gene under the control of an inducible promoter. After expression, the identity of the overproduced protein can be confirmed through immunoblot analysis and amino acid sequencing . The overproduction level is typically determined densitometrically on stained SDS gels, with overexpression fold calculated through immunoblot analysis compared to normal expression levels .

What purification methods are most effective for recombinant SecD?

The purification of SecD involves a multi-step process:

  • Differential solubilization of the SecD-overproduced membrane fraction

  • Ion-exchange chromatography to separate SecD from other membrane proteins

  • Size-exclusion chromatography for final purification

This approach yields purified SecD suitable for functional and structural studies. In contrast, SecF protein can be purified through size exclusion chromatography alone, suggesting differences in their physicochemical properties despite their functional relationship .

How can researchers verify the identity and purity of recombinant SecD?

Verification of recombinant SecD identity and purity involves multiple complementary techniques:

  • Immunoblot analysis using SecD-specific antibodies to confirm identity

  • Amino acid sequencing of the purified protein to verify the primary structure

  • SDS-PAGE to assess purity and estimate molecular weight

  • Densitometric analysis to quantify purity percentage

These methods collectively ensure that the purified protein is indeed SecD and not contaminated with other proteins from the expression host.

How can proteoliposomes be reconstituted with SecD for functional studies?

Proteoliposome reconstitution with SecD is a sophisticated approach for studying protein translocation in vitro. The methodology involves:

  • Purification of individual Sec components (SecD, SecF, SecE, and SecY)

  • Incorporation of these purified proteins into lipid vesicles to form proteoliposomes

  • Verification of proper incorporation through immunodetection methods

  • Assessment of translocation activity using model substrate proteins

This system allows researchers to study the contribution of individual components to the translocation process. Interestingly, proteoliposomes reconstituted with purified SecD and SecF together with SecE and SecY did not show significant enhancement of translocation activity compared to proteoliposomes lacking these components, suggesting their function may be regulatory or depend on other factors not present in the minimal reconstituted system .

How does the overexpression of recombinant SecD affect the levels of other Sec translocon components?

The overproduction of SecD has significant consequences for the homeostasis of the Sec translocon. Research has shown that overexpression of recombinant proteins targeted to the Sec pathway (including SecD) results in altered levels of other translocon components, specifically:

  • Increased levels of SecY, a core component of the translocon

  • Decreased levels of SecE, another essential component

What quality control systems ensure proper SecD function in protein translocation?

Bacteria have evolved sophisticated quality control systems to maintain the integrity of Sec-dependent protein translocation, which include mechanisms relevant to SecD function:

  • The DnaK/DnaJ chaperone system helps maintain Sec substrates in a translocation-competent conformation, preventing premature folding in the cytoplasm

  • The GroEL/GroES chaperone system assists in preventing misfolding of Sec substrate proteins

  • Cytoplasmic peptidase PrlC (oligopeptidase A) assists Sec-dependent protein translocation by potentially degrading free signal sequences that could competitively inhibit protein translocation

  • FtsH protease degrades SecY when translocation is inhibited, which serves as a quality control mechanism but can become detrimental during severe stress conditions

These systems work together to ensure that SecD and other Sec components function properly in protein translocation, preventing the accumulation of misfolded proteins and maintaining cellular homeostasis.

How can single-case experimental designs be applied to study SecD function in various conditions?

Single-case experimental designs (SCEDs) offer a powerful approach to studying SecD function under varying conditions, particularly when investigating individualized effects or rare phenotypes. The application of SCEDs to SecD research could involve:

  • Phase designs (AB, ABA) to establish baseline SecD function and then introduce experimental variables

  • Incorporation of randomization elements to strengthen internal validity

  • Multiple baseline designs across different experimental conditions to demonstrate experimental control

  • Analysis using visual tools, effect size measures, and randomization inference

SCEDs can be particularly useful for investigating how SecD function changes under various stress conditions or in response to specific mutations, providing a rigorous experimental framework for individualized analysis.

What statistical approaches are recommended for analyzing SecD functional data?

  • Clearly defined research questions and hypotheses about SecD function

  • Specific effect measures of interest (e.g., translocation efficiency, protein interaction strength)

  • Defined populations and variables to be analyzed

  • Statistical methods appropriate for the data structure (e.g., regression analysis, parametric or non-parametric tests)

  • Plans for handling missing data or outliers

  • Power calculations to ensure sufficient sample size for detecting clinically important effects

When reporting results, researchers should clearly state that the results were generated after completion of the original studies, describe any deviations from the SAP, discuss potential biases or confounding factors, and address both statistical significance and clinical relevance .

How does posttranslational targeting of recombinant proteins to the Sec translocon affect SecD function?

The targeting pathway used for recombinant proteins significantly impacts Sec translocon function, including SecD activity. Proteins can be directed to the Sec translocon either cotranslationally via the signal recognition particle (SRP) pathway or posttranslationally via the SecA/SecB-dependent pathway . Research has shown that:

  • The route chosen affects the efficiency of protein translocation

  • Posttranslational targeting may put different demands on the Sec machinery compared to cotranslational targeting

  • In both targeting pathways, overexpression of recombinant proteins results in increased levels of SecY and decreased levels of SecE, affecting the ratio of these components and potentially reducing the number of functional translocons

What experimental methods can detect SecD interactions with other translocon components?

Detecting interactions between SecD and other translocon components requires sophisticated biophysical and biochemical approaches:

MethodApplication to SecDAdvantagesLimitations
ImmunoprecipitationPulls down SecD and interacting partnersIdentifies stable interactionsMay miss transient interactions
Chemical crosslinkingCaptures transient SecD interactionsPreserves in vivo interactionsCan create artifacts
FRET/BRETMeasures proximity of SecD to other componentsReal-time in vivo measurementsRequires fluorescent tagging
Proteoliposome reconstitutionTests functional interactionsControlled environmentMay not reflect in vivo complexity
Genetic suppressor analysisIdentifies functional relationshipsReveals physiologically relevant interactionsIndirect evidence of interaction

These methods can be used complementarily to build a comprehensive understanding of SecD's interaction network within the Sec translocon.

How can researchers troubleshoot poor expression of recombinant SecD?

Poor expression of recombinant SecD can result from several factors. A systematic troubleshooting approach should consider:

  • Expression vector design: Ensure appropriate promoter strength, codon optimization for the host organism, and proper fusion tags if used

  • Growth conditions: Optimize temperature, induction timing, and media composition

  • Host strain selection: Different E. coli strains have varying capacities for membrane protein overexpression

  • Toxicity effects: SecD overexpression may disrupt the native Sec machinery, leading to growth defects and reduced yields

  • Quality control systems: The bacterial AID (Authorization, Inspection, and Destruction) quality control system may degrade misfolded or mislocalized SecD

Researchers should systematically vary these parameters and monitor SecD expression through immunoblotting to identify optimal conditions.

How can recombinant SecD be used to study antibiotic resistance mechanisms?

The Sec pathway represents a potential target for antibiotics, and studying SecD can provide insights into resistance mechanisms:

  • SecD mutants can be analyzed for altered sensitivity to antibiotics that target protein secretion

  • Recombinant SecD can be used in in vitro assays to screen potential inhibitors of protein translocation

  • Understanding SecD structure-function relationships may reveal novel antibiotic targets

  • Comparative analysis of SecD from different bacterial species may explain species-specific antibiotic sensitivities

These approaches could lead to the development of new antibiotics targeting the bacterial protein secretion machinery.

What are the most promising research directions for understanding SecD function in different bacterial species?

Future research on SecD should focus on several promising directions:

  • Comparative genomics and proteomics to understand SecD evolution and specialization across bacterial species

  • Cryo-EM studies of the complete Sec translocon with SecD in different functional states

  • Single-molecule studies to observe SecD dynamics during protein translocation

  • Systems biology approaches to understand how SecD integrates with other cellular processes

  • Application of randomized single-case experimental designs to study the effects of SecD mutations or environmental conditions on protein translocation efficiency

These approaches will provide a more comprehensive understanding of SecD's role in bacterial physiology and potentially reveal new strategies for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.