Recombinant Protein translocase subunit SecY (secY)

Shipped with Ice Packs
In Stock

Description

Structure and Composition

SecY is an integral membrane protein characterized by a complex topology. It typically consists of 10 transmembrane segments, with both the amino and carboxyl termini located in the cytoplasm . The protein also includes six cytoplasmic domains and five periplasmic domains .

  • Transmembrane Segments These segments anchor SecY within the lipid bilayer, forming a channel through which polypeptide chains can pass .

  • Cytoplasmic Domains These domains are located on the cytoplasmic side of the membrane and are involved in interactions with other components of the translocation machinery, such as SecA, ribosomes, and other regulatory proteins .

  • Periplasmic Domains Located on the opposite side of the membrane, these domains play a role in the exit and folding of the translocated proteins .

The bacterial SecY complex includes two other subunits, SecE and SecG, which stabilize SecY and modulate its activity . SecE stabilizes the hinge at the back of SecY, and SecG, while not essential, enhances protein transport efficiency .

Functional Mechanism

SecY serves as a protein-conducting channel, allowing the passage of secreted and membrane proteins across the cell membrane . The process involves several key steps:

  1. Substrate Targeting Hydrophobic signal sequences on the N-terminus of presecretory proteins target them to the SecYEG complex .

  2. Channel Activation SecA, an ATPase motor protein, binds to SecYEG and uses ATP hydrolysis to drive the translocation of the polypeptide chain through the SecY channel . The 2HF domain of SecA inserts into the cytoplasmic vestibule of SecY, facilitating the opening of the lateral gate .

  3. Lateral Gate Dynamics The lateral gate, formed by transmembrane segments 2/3 and 7/8 of SecY, allows access to the lipid phase . The opening and closing of this gate are essential for the integration of transmembrane segments into the lipid bilayer during the insertion of membrane proteins .

  4. Pore Ring Expansion and Plug Movement Activation of the SecYEG channel requires the expansion of the pore ring and the movement of a short helix (TM2a; the plug), which seals the channel in its resting state . These movements are crucial for accommodating the translocating polypeptide .

  5. Polypeptide Translocation The polypeptide chain moves through the SecY channel, driven by the mechanical force generated by SecA . This process is stepwise and ATP-dependent, ensuring efficient and controlled translocation .

Interactions with Other Proteins

SecY interacts with several key proteins to facilitate protein translocation:

  • SecA SecA binds to SecY and uses ATP hydrolysis to drive protein translocation. The interaction between SecA and SecY is essential for initiating and sustaining the translocation process . SecA recognizes proteins with cleavable signal sequences and provides the energy for translocation via ATP hydrolysis cycles .

  • Ribosomes SecY interacts with ribosomes, particularly when translocating membrane proteins. The interaction ensures that the nascent polypeptide chain is directly inserted into the SecY channel as it is being synthesized .

  • SecE and SecG These subunits are integral parts of the SecYEG complex and stabilize SecY. SecE is crucial for the integrity of SecY, while SecG enhances the efficiency of protein transport .

  • FtsY In some pathways, SecY interacts with FtsY, a signal recognition particle (SRP) receptor, to target specific proteins to the membrane .

These interactions are dynamic and regulated, ensuring that proteins are efficiently targeted and translocated under various cellular conditions.

Functional Significance

SecY plays an indispensable role in protein translocation, essential for cell viability and function . Its primary functions include:

  • Protein Secretion Facilitating the transport of proteins destined for the periplasm or extracellular space .

  • Membrane Protein Insertion Integrating newly synthesized membrane proteins into the lipid bilayer .

  • Quality Control Ensuring that misfolded or damaged proteins are properly translocated for degradation .

Mutations in SecY can lead to severe defects in protein translocation, resulting in non-functional proteins and compromised cell viability .

5.1. Single-Molecule Studies

Single-molecule techniques have provided insights into the dynamics of SecY during protein translocation. These studies have revealed that SecY undergoes conformational changes on multiple timescales, essential for the translocation process .

5.3. Mutational Analysis

Targeted mutagenesis of SecY has identified critical amino acid residues essential for its function . For example, mutations in the cytoplasmic domain 5 of SecY can disrupt its interaction with SecA, impairing protein translocation .

SecY-SecA Fusion Proteins

Studies using SecY-SecA fusion proteins have demonstrated that a single unit of the SecYAEG complex (SecY-SecA/SecE/SecG) is sufficient to mediate protein translocation in vitro . This suggests that the minimal functional unit for protein translocation comprises one SecYAEG complex .

Table 1: Key Components Interacting with SecY

ComponentFunctionInteraction Site
SecAATPase, drives protein translocationCytoplasmic domains, particularly C5
RibosomesDelivers nascent polypeptide chainsCytoplasmic loops of SecY
SecEStabilizes SecY, maintains complex integrityTransmembrane segment 3
SecGEnhances protein transport efficiencyAssociates with SecY and SecE
FtsYTargets specific proteins to the membrane (in some pathways)Cytosolic loops of SecY

Table 2: Effects of Mutations on SecY Function

MutationLocationEffect
R357HCytoplasmic domain 5Cold-sensitive, export-defective
R357ECytoplasmic domain 5Markedly compromised SecYEG translocase activity
T362RCytoplasmic domain 5Less severe SecY defects compared to R357E

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. Please specify your desired tag type for prioritized development.
Synonyms
secY; Protein translocase subunit SecY; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Paracoccus denitrificans
Target Names
secY
Target Protein Sequence
IFASSLLLLPVTISTFSGNQTGPIMSTVLAYFGPGQPLYLLFFAAMIVFFTYFYTYNVSF KTEDVAENLKNQGGFIPGIRPGKRTEDYLTYVVTRVLVIGSAYLAFVCLLPAARDHPRPA GDPLLLGGTSVLIVVSVVMDTINQVQSHLLAHQYEGLIEKSQLPGKRGKTGAAKPRKAPA RR
Uniprot No.

Target Background

Function
SecY is the central subunit of the SecYEG protein translocation channel. It comprises two halves formed by transmembrane segments (TMs) 1-5 and 6-10. These domains create a lateral gate opening onto the bilayer between TMs 2 and 7, held together by SecE. The channel's closure is mediated by a hydrophobic SecY residue pore ring and a short extracellular helix (helix 2A) acting as a plug. Lateral movement of the plug likely facilitates channel opening, potentially independent of the ring and pore movement.
Protein Families
SecY/SEC61-alpha family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the core composition of the SecYEG translocon and what role does SecY play?

The SecYEG translocon consists of three membrane proteins: SecY, SecE, and SecG. SecY and SecE form the essential protein-conducting channel in the cytoplasmic membrane, with SecY providing the primary conduit for protein passage. In the absence of SecE, SecY is degraded by the cytoplasmic membrane protease FtsH . SecG is non-essential but enhances translocation efficiency. The SecY protein contains the lateral gate that opens to allow signal sequence insertion and protein translocation across or into the membrane .

How does the SecYEG translocon interact with different targeting pathways?

The SecYEG translocon interacts with two main targeting pathways:

  • SRP pathway: Primarily for inner membrane proteins and some secretory proteins. SRP recognizes signal sequences of nascent chains emerging from ribosomes and targets ribosome-nascent chain complexes (RNCs) to the SecYEG translocon via the SRP receptor FtsY .

  • SecA pathway: Primarily for secretory proteins. SecA recognizes signal sequences post-translationally or co-translationally, binds to the SecYEG translocon, and uses ATP hydrolysis to push proteins through the channel .

Both FtsY and SecA use largely identical binding sites on SecY, suggesting a potential competitive regulation mechanism .

What are effective approaches for studying SecY structure-function relationships?

Effective approaches include:

  • Cryo-electron microscopy (Cryo-EM): Provides structural information on SecYEG complexes with SecA, ribosomes, and nascent chains. This has revealed key conformational changes during channel activation and protein translocation .

  • Atomic Force Microscopy (AFM): Enables direct visualization of SecYEG translocases in lipid bilayers under near-native conditions, allowing observation of conformational changes during active translocation .

  • Cross-linking studies: Identify protein-protein interactions between SecY and other components of the translocation machinery, such as SecA, ribosomes, and substrate proteins .

  • Site-directed mutagenesis: Identifies functionally important residues in SecY, particularly at the lateral gate, pore ring, and cytoplasmic loops that interact with SecA and ribosomes .

How can researchers optimize recombinant SecY expression for structural and functional studies?

Optimizing recombinant SecY expression is challenging due to its essential nature and tendency to be degraded when not properly assembled. Several methodological approaches can help:

  • Co-expression with SecE: Always co-express SecY with SecE to prevent degradation by FtsH protease .

  • Tunable expression systems: Use systems like the rhamnose promoter-based setup to precisely control SecY expression levels, which allows harmonization with cellular capacity .

  • Membrane protein overexpression strains: Use E. coli strains specifically engineered for membrane protein overexpression, which have adaptations in their protein translocation machinery .

  • Fusion partners: Employ fusion partners that enhance stability and expression, but ensure they don't interfere with the functional regions of SecY.

How is the opening of the SecY lateral gate regulated during protein translocation?

The SecY lateral gate opening is regulated through a step-wise process:

  • Initial activation: Binding of SecA or the ribosome to the cytoplasmic loops of SecY causes small conformational changes that partially open the cytoplasmic side of the lateral gate .

  • Signal sequence insertion: The signal sequence of the substrate protein intercalates within the partially opened lateral gate, with its hydrophobic segment positioned between transmembrane helices TM2 and TM7 .

  • Full opening: Complete opening of the channel requires movement of the plug domain away from the central pore, which occurs during active translocation .

  • ATP-dependent dynamics: For SecA-dependent translocation, ATP binding and hydrolysis cycles drive conformational changes in SecA's two-helix finger (2HF) domain, which inserts into the cytoplasmic vestibule of SecY and facilitates substrate movement .

These conformational changes have been observed in multiple structural studies and are supported by biochemical data .

What mechanisms coordinate the access of different factors (SecA, ribosomes, FtsY) to the SecYEG translocon?

The coordination of different factors accessing SecYEG remains incompletely understood, but several mechanisms have been proposed:

  • Competitive binding: SecA, ribosomes, and FtsY engage largely identical binding sites on SecY, particularly the cytoplasmic loops (C4 and C5), suggesting they compete for SecYEG binding .

  • Membrane microdomains: Different SecYEG populations may exist in specialized membrane domains that preferentially interact with either SecA or FtsY.

  • Accessory factors: Additional proteins may regulate the accessibility of SecYEG to different targeting factors.

  • Substrate-dependent regulation: The nature of the substrate protein being translocated may influence which targeting pathway is utilized .

Research using direct visualization techniques like AFM has shown that SecA association with SecYEG is substrate-dependent, with SecA more readily dissociating when engaged with certain substrates (like OmpA) compared to others (like GBP) .

How does the bacterial cell adapt its protein translocation machinery when recombinant proteins are overexpressed?

Bacteria can adapt their protein translocation machinery in response to recombinant protein overexpression:

  • Upregulation of key components: Proteome analysis shows that enhanced periplasmic production of recombinant proteins (e.g., human Growth Hormone) is accompanied by increased levels of:

    • SecA (the peripheral motor of the Sec-translocon)

    • LepB (leader peptidase)

    • YidC (cytoplasmic membrane protein integrase/chaperone)

  • Dynamic adaptation: These changes are reversible—when cells with enhanced periplasmic protein production are harvested and cultured without inducer, SecA, LepB, and YidC levels decrease again .

  • Translocation capacity adjustment: The cell appears to increase its Sec-translocon capacity, enhance signal peptide cleavage capacity, and utilize alternative membrane protein biogenesis pathways (via YidC) to free up Sec-translocon capacity for protein secretion .

This adaptive response highlights the importance of precisely setting production rates to harmonize with the protein translocation capacity of the cell .

What quality control systems prevent misfolding of SecY substrates in the cytoplasm?

Several quality control systems work to prevent the misfolding of SecY substrates in the cytoplasm:

  • Avoid-Inhibit-Destroy (AID) systems: A network of quality control mechanisms that includes:

    • Avoid: Co-translational recognition of nascent Sec substrates by SRP or SecA, preventing the existence of cytoplasmic intermediates .

    • Inhibit: Recruitment of chaperones like SecB to hold substrates in translocation-competent conformations .

    • Destroy: Degradation of mislocalized Sec substrates by proteases .

  • Cytoplasmic peptidases: PrlC (oligopeptidase A) assists Sec-dependent protein translocation by potentially removing signal sequences from mislocalized Sec substrates in the cytoplasm .

  • FtsH protease system: Monitors SecY quality and degrades uncomplexed forms of SecY, preventing accumulation of non-functional translocons .

These systems help maintain protein homeostasis by preventing the accumulation of misfolded secretory proteins in the cytoplasm, which could lead to a detrimental feedback loop that overwhelms the translocation machinery .

How do the mechanisms of co-translational vs. post-translational translocation differ for various SecY substrates?

The mechanisms differ in several key aspects:

  • Targeting phase:

    • Co-translational: SRP recognizes signal sequences early during translation and targets ribosome-nascent chain complexes to SecYEG via FtsY .

    • Post-translational: SecA recognizes completed or nearly completed proteins, often with SecB assistance to maintain translocation competence .

  • Channel activation:

    • Co-translational: The ribosome binding to SecY causes conformational changes that slightly open the cytoplasmic part of the lateral gate .

    • Post-translational: SecA insertion of its two-helix finger into SecY's cytoplasmic vestibule activates the channel .

  • Energy source:

    • Co-translational: Translation itself provides directional force for translocation.

    • Post-translational: SecA ATPase activity provides mechanical force (approximately 10pN) for protein movement through SecYEG .

  • Hybrid cases: Some proteins use combined mechanisms, such as membrane proteins with large periplasmic domains that are inserted co-translationally but require SecA for periplasmic domain translocation, or membrane proteins like RodZ that are co-translationally targeted by SecA .

What factors determine whether SecA dissociates from SecYEG during translocation, and how does this affect translocation efficiency?

Recent atomic force microscopy (AFM) studies provide insight into this question:

These findings, acquired under near-native conditions, suggest that translocation mechanisms are more diverse and substrate-specific than previously thought .

How might structural dynamics of SecY be harnessed for biotechnological applications in recombinant protein production?

Understanding SecY dynamics could enhance recombinant protein production through several approaches:

  • Engineered SecY variants: Designing SecY mutants with altered lateral gate dynamics or substrate specificities could enhance translocation of specific recombinant proteins.

  • Pathway optimization: Favoring co-translational or post-translational pathways based on recombinant protein characteristics by modulating SecA, SRP, or FtsY levels.

  • Synchronized expression: Developing expression systems that synchronize recombinant protein production rates with the cell's translocation capacity, based on findings that E. coli can adapt its translocation machinery (SecA, LepB, YidC) in response to secretory protein load .

  • Precursor-specific strategies: Since translocation processes vary with precursor species , tailoring signal sequences and translocation conditions to specific recombinant proteins could improve yields.

  • Quality control integration: Engineering improved interfaces between the AID (Avoid-Inhibit-Destroy) quality control systems and recombinant protein production to minimize cytoplasmic misfolding and aggregation .

What role might alternative translocation pathways play in supplementing SecYEG function during recombinant protein production?

Alternative translocation pathways could be valuable supplements to SecYEG:

  • YidC pathway: The YidC insertase/chaperone, which normally assists membrane protein biogenesis in conjunction with or independent of SecYEG, is upregulated during enhanced periplasmic recombinant protein production . This suggests YidC might help free up SecYEG capacity by handling certain membrane proteins.

  • Tat pathway: The Twin-arginine translocation (Tat) system translocates folded proteins across the cytoplasmic membrane, unlike the Sec pathway which transports unfolded proteins . The Tat pathway's unique quality control mechanism prevents translocation of improperly folded proteins , making it potentially valuable for certain recombinant proteins that fold in the cytoplasm.

  • Hybrid systems: Engineered translocation systems combining elements of Sec and Tat pathways could potentially offer new solutions for difficult-to-express recombinant proteins.

  • Coordinated expression strategies: Simultaneously modulating multiple translocation pathways could allow cells to maintain optimal protein export capacity despite high recombinant protein production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.