Recombinant Protein Tra (tra)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Protein Tra (tra)

Recombinant Protein Tra (tra) is a protein originally identified in the bacterium Streptomyces lividans, with a UniProt identification number of P22409 . The protein is encoded by the tra gene located on the plasmid pIJ101 of S. lividans, and was formerly referred to as kilA in scientific literature . This protein represents an important component in bacterial genetics and has been studied to understand its molecular properties and biological functions. The recombinant production of this protein has facilitated detailed characterization and exploration of its potential applications in various research contexts. As a recombinant protein, it can be expressed in heterologous systems, most commonly Escherichia coli, to produce pure preparations for scientific investigation and biotechnological applications.

Molecular Weight and Physical Properties

While specific details about the molecular weight are not explicitly stated in the search results for the native protein, recombinant forms may have additional weight due to fusion tags. The physical properties of the protein, including solubility and stability characteristics, are important considerations for its recombinant production and subsequent handling in laboratory settings.

Expression in Escherichia coli

Recombinant Protein Tra is typically expressed in Escherichia coli expression systems, which represent one of the most widely used platforms for heterologous protein production . E. coli offers several advantages for recombinant protein expression, including rapid growth, high protein yields, and well-established genetic manipulation techniques. The bacterial expression system enables efficient production of the Tra protein for research and commercial purposes. The expression of Tra protein in E. coli involves the transformation of appropriate host strains with expression vectors containing the tra gene sequence optimized for bacterial expression.

Protein Tags and Fusion Partners

To facilitate purification and enhance protein solubility, recombinant Tra protein is commonly produced with fusion tags. One common approach is the addition of a histidine (His) tag at the N-terminus of the protein . The His-tagged version enables efficient purification through immobilized metal affinity chromatography (IMAC), allowing for the isolation of the target protein from complex bacterial lysates. Other tag types may also be employed depending on the specific requirements of downstream applications, as noted in commercial product descriptions .

Purification and Quality Control

Commercial preparations of recombinant Tra protein undergo rigorous purification and quality control processes to ensure high purity and functional integrity. The purity of these preparations is typically assessed using sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), with commercial products often achieving greater than 85-90% purity . This high level of purity is essential for research applications requiring reliable and consistent protein preparations.

SpecificationDetails
SourceE. coli
Protein LengthFull Length (1-621) or Partial
FormLyophilized powder
TagHis (N-terminal) or other tags as determined during manufacturing
Purity>85% or >90% as determined by SDS-PAGE
ApplicationsSDS-PAGE, research applications
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Table 1: Specifications of commercially available recombinant Tra protein products .

Transcriptional Regulation Mechanisms

The expression of the tra gene in Streptomyces lividans is regulated at the transcriptional level by two key loci: korA and korB . These regulatory elements function as transcriptional repressors, controlling the expression of the tra gene and maintaining appropriate levels of the protein within the bacterial cell. Research has demonstrated that mutations in the translational open reading frames within these kor loci can abolish the repression of genes directed by the tra promoter, highlighting their critical role in regulation .

Regulatory Proteins and Their Functions

The korA locus encodes a 31 kDa protein, while the korB locus produces a 10 kDa protein that correspond in size to the products expected from the sequences of their respective open reading frames . These proteins function as transcriptional repressors in the pIJ101 kil/kor gene system. Experimental evidence suggests that these proteins directly control the expression of the tra gene, with mutations affecting the KorA or KorB phenotype altering the structure of, or eliminating, the protein products of the respective open reading frames . This regulatory system represents an important mechanism for controlling tra gene expression and subsequently the levels of Tra protein in the native bacterial host.

Reconstitution Guidelines

For the reconstitution of lyophilized recombinant Tra protein, the following procedure is recommended:

  1. Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  2. Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (with 50% being the common default)

  4. Prepare aliquots for long-term storage at -20°C/-80°C

These reconstitution guidelines ensure that the protein maintains its structural integrity and functional properties for subsequent experimental applications.

Buffer Formulation and Additives

Commercial recombinant Tra protein products are often supplied in specific buffer formulations designed to maintain protein stability. For instance, one product is provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . The inclusion of stabilizing agents such as trehalose helps to preserve protein structure during storage and reconstitution processes. The specific buffer composition may vary between different commercial products and should be considered when planning experiments that may be sensitive to buffer components.

Applications in Molecular Biology Research

Recombinant Tra protein serves as a valuable tool for studying bacterial plasmid biology, particularly in Streptomyces species. It provides opportunities for investigating gene regulation mechanisms, protein-protein interactions, and plasmid-related functions. The availability of purified recombinant protein facilitates detailed structural and functional studies that contribute to our understanding of bacterial genetics and molecular biology.

Potential Biotechnological Applications

While the specific biotechnological applications of recombinant Tra protein are not explicitly detailed in the search results, recombinant proteins in general have numerous potential applications in research and biotechnology. These may include:

  • Fundamental research into bacterial genetics and plasmid biology

  • Development of novel genetic tools and expression systems

  • Investigation of protein-protein interactions and regulatory networks

  • Exploration of applications in biotechnology and synthetic biology

The continued study of recombinant Tra protein may reveal additional applications based on its unique structural and functional properties.

Current Research Trends

Recent research on recombinant proteins has focused on optimizing expression systems and improving production yields. One significant advancement in the field involves analyzing the accessibility of translation initiation sites to enhance recombinant protein production efficiency . Studies have shown that about 50% of recombinant proteins fail to be expressed in various host cells, highlighting the ongoing challenges in this field . Improved understanding of the factors influencing successful protein expression, such as mRNA accessibility modeling, has led to the development of tools like TIsigner that can modify codons to enhance expression levels .

Future Research Directions

Future research on recombinant Tra protein may focus on exploring its structural details through advanced techniques such as X-ray crystallography or cryo-electron microscopy. Additionally, investigations into the protein's functional roles and potential applications in biotechnology and synthetic biology represent promising avenues for future study. As recombinant protein production technologies continue to advance, improvements in expression systems and purification methods may further enhance the availability and utility of recombinant Tra protein for research and applications.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate it during your order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributors for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specification.
Synonyms
tra; kilA; Protein Tra
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-621
Protein Length
full length protein
Species
Streptomyces lividans
Target Names
tra
Target Protein Sequence
MAPTLAPFAARWDAEADRRMALRTPEHLKALMDAQKGYNSARSTAATAKSQRTAARAASK NPLSTVRRAARTADKAARTHRDQAKTKLKAARKDYPATLRARAVQAHAMHAVPGAGISAL GWDQAGAWPVAGSLALIAANVAALVIGRRKVAVAVADELSAEERRLVERLDPSYWAQHAD ERGLVGTVTTPVQVTPAGLVTTVRLDGRWKPSAFKAKHEEIRALLGARTDLRMEIKAGSH GDRAVITLRTRSAADGIDLTGWTPGAPWGVDTVTGEPVQVPLGRRMLIAGTSGSGKSWST RALLAEGSEYADHRLVVVDPKRVEAINWQHRARTAISIEDVLDVTDELVEEMHERLELIP RGQDVIQISPERPRITVFIDEGAEVIAMAKKTRAKGSKEEPGDPDWSRIMENLSTLARMA RAAEIILIWATQKPTMDAKGGIDPQISAQITYRAALALSTSGESRVVFGEDATEKGWHAH ELPMPGVAMLRSGPKVQPHPINTRAFSPADVIALPDRPVWRRQESPARSAGASAPAPLRL VKETAPAAEVPAQPTKAPTNREKVAAAIGTGATTVADVATVTGINKGSVSKAVKQLLDAG EVLRSEDGSLSVVTQVGEVSA
Uniprot No.

Target Background

Function
Essential protein for plasmid transfer.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the major expression systems for recombinant proteins?

Recombinant proteins can be expressed in various host systems, each with distinct advantages. Escherichia coli remains the most widely used bacterial host due to its rapid growth, well-characterized genetics, and high protein yields. The pET vector system with T7 RNA polymerase is extremely popular and can represent up to 50% of total cell protein in successful cases . For proteins requiring post-translational modifications (PTMs), mammalian expression systems are preferred, with Chinese hamster ovary (CHO) cells being the predominant choice for biopharmaceutical production. CHO cells have become the main host cells for producing recombinant therapeutic proteins because of their ability to perform PTMs such as correct folding and glycosylation . This expression system has been used to produce 84% of the antibodies approved during 2015–2018 .

How do induction systems work in E. coli recombinant protein expression?

Induction systems in E. coli provide temporal control over recombinant protein expression. The most common system utilizes the T7 promoter technology in conjunction with IPTG (isopropyl β-D-1-thiogalactopyranoside) induction. In this system, the gene of interest is cloned behind a promoter recognized by the phage T7 RNA polymerase (T7 RNAP). The T7 RNAP gene is typically placed in the bacterial genome under the transcriptional control of a lacUV5 promoter, making it inducible by lactose or IPTG .

Alternative induction methods include:

  • L-rhamnose inducible systems, which offer more tunable expression levels. At higher concentrations of L-rhamnose, more T7 lysozyme is produced, less active T7 RNAP is present, and less recombinant protein is expressed .

  • Temperature-sensitive systems like the pL promoter with the mutant λcI repressor, which responds to physical signals rather than chemical cues .

What are the common challenges in recombinant protein expression?

Researchers often encounter several challenges when expressing recombinant proteins:

  • Protein solubility issues and inclusion body formation

  • Low expression levels due to codon bias

  • Protein misfolding and degradation

  • Toxicity of the expressed protein to the host cell

  • Insufficient post-translational modifications

For bacterial expression systems, codon bias is a significant concern. When the cell produces massive amounts of proteins, charged tRNA availability for rare codons becomes a major determinant of expression levels . Low-abundance tRNA depletion causes ribosome stalling, leading to translation termination and failure to generate full-length products .

In mammalian expression systems like CHO cells, challenges include growth restriction, expression instability, low resistance to culture-related stresses, and high production costs. These issues can be attributed to factors affecting intracellular protein processing such as cellular secretory capacity, protein aggregation or degradation, and protein folding difficulties .

How can codon optimization enhance recombinant protein expression?

Codon optimization represents a sophisticated strategy for improving recombinant protein expression by addressing the codon bias of the expression system. The technique involves modifying the nucleotide sequence without changing the amino acid sequence to better match the tRNA pool of the host organism.

In recombinant protein production, expression rate, yield, and final product quality are all affected by the codon bias of the relevant gene and the codon bias of the expression system . Although all codons affect the translation rate, some codons are rapidly decoded while others cause ribosome pausing due to the relative cognate tRNA concentration .

Methodological approach to codon optimization:

  • Analyze the codon usage bias of the target gene and host organism

  • Replace rare codons with synonymous codons that are more abundant in the host

  • Consider GC content at the third position of each codon

  • Avoid repetitive sequences and RNA secondary structures

  • Eliminate potential cryptic splice sites or internal promoters

Evidence of effectiveness: Heterologous expression of recombinant human interferon beta (rhIFN-β) gene in suspension-adapted Chinese hamster ovary (CHO-s) cells with optimized codons to increase the GC content at the third position of each codon increased the expression level by 2.8-fold .

What strategies can mitigate protein folding and secretion limitations?

Protein folding and secretion represent key bottlenecks in recombinant protein expression, particularly for complex proteins with multiple domains or disulfide bonds. When unfolded or misfolded proteins accumulate in the endoplasmic reticulum (ER) beyond its handling capacity, ER stress and unfolded protein response (UPR) are triggered, potentially leading to apoptosis and reduced yields .

Advanced strategies to address these limitations include:

  • Chaperone co-expression: Co-expressing molecular chaperones (such as DnaK, DnaJ, GrpE, GroEL, and GroES in E. coli) to assist proper protein folding.

  • Transcription factor engineering: Overexpression of transcription factors such as ZFP-TF, ATF4, or GADD34 has significantly increased the yield of various cellular recombinant proteins compared with parental cells, up to 10-fold .

  • mTOR pathway modulation: Enhancing the ectopic expression of mammalian target of rapamycin (mTOR) gene can significantly improve cell growth, proliferation, viability, and specific productivity of secreted human glycoproteins in CHO cells. Studies have shown that an mTOR transgenic CHO-derived cell line for immunoglobulin secretion achieved a fourfold increase in antibody production (50 pg/cell/day) compared to the parental production cell line .

  • 5' UTR engineering: Insertion of regulatory elements (RGEs) into the 5' untranslated region (5' UTR) RNA hairpin structure can improve expression efficiency .

How do specialized E. coli strains overcome limitations in recombinant protein expression?

Specialized E. coli strains have been engineered to address specific limitations in recombinant protein expression. Understanding their unique properties allows researchers to select the optimal strain for their target protein.

The BL21(DE3) strain and its derivatives are by far the most used strains for protein expression . Key specialized strains include:

  • BL21(DE3)pLysS/pLysE: Contains the pLys plasmid expressing T7 lysozyme, which binds to T7 RNAP and inhibits transcription initiation from the T7 promoter, effectively controlling basal expression. After induction, the amount of T7 RNAP produced surpasses the level that T7 lysozyme can inhibit, enabling transcription of the recombinant gene .

  • AD494 and Origami™: These K-12 derivative strains are trxB (thioredoxin reductase) mutants, enhancing disulfide bond formation in the cytoplasm. The Origami strain additionally lacks the glutathione reductase gene, further promoting disulfide bond formation .

  • HMS174: A recA mutant from the K-12 lineage that exhibits improved plasmid stability. The recA mutation prevents plasmid multimer formation, an important cause of instability that relies on the recombination system of E. coli .

  • BL21(DE3)CodonPlus and Rosetta(DE3): These strains contain additional tRNA genes for rare codons. BL21(DE3)CodonPlus carries the pRIL plasmid providing extra tRNAs for AGG/AGA (Arg), AUA (Ile), and CUA (Leu). The Rosetta(DE3) strain contains the pRARE plasmid, supplying tRNAs for all the above-mentioned codons plus GGA (Gly) .

A methodological consideration: While these specialized strains often improve protein production levels, they may sometimes decrease protein solubility. Research has shown that proteins with higher than 5% content of RIL codons (AGG/AGA, AUA, and CUA) are less soluble when expressed in the CodonPlus strain because the translational pauses introduced by these codons are overridden, increasing translation speed and consequently, protein aggregation .

What role does mRNA stability play in recombinant protein yields?

The stability of mRNA molecules represents a critical yet often overlooked factor affecting recombinant protein expression levels. mRNA produced during transcription is prone to degradation, and its degradation rate directly influences protein expression .

Key factors affecting mRNA stability and processing in recombinant expression systems:

  • Codon selection and ribosome elongation: Studies have found that codon selection affects the rate of ribosome elongation, which in turn influences mRNA degradation rates .

  • Post-transcriptional processing: Mature mRNAs undergo capping, splicing, and polyadenylation before translation. The efficiency of these processes affects mRNA stability and translational efficiency .

  • Translation initiation factors: The structure and composition of eukaryotic initiation factors (eIFs) and ribosomal proteins can influence translation initiation and co-translational mRNA degradation .

Importantly, researchers should note that mRNA levels and protein expression levels are not always consistent , suggesting that post-transcriptional regulation plays a significant role in determining final protein yields. This highlights the importance of considering both transcriptional and post-transcriptional processes when optimizing recombinant protein expression systems.

How can researchers detect and address post-translational modification issues?

Post-translational modifications (PTMs) are crucial for proper protein function and are typically performed through proteolytic cleavage or covalent modification of amino acids. PTMs may lead to changes in protein characteristics and function . Detecting and addressing PTM issues requires systematic analytical approaches.

Issues with PTMs can arise from:

  • Improper protein design or inappropriate DNA coding sequences

  • Insufficient supply of chaperones

  • Difficulty in forming interchain and intra-chain disulfide bonds

  • Ineffective vesicle transport

  • Adverse protein-protein interactions

Analytical methods for characterizing PTMs include:

  • Mass spectrometry (MS) to identify specific modifications

  • Western blotting with modification-specific antibodies

  • 2D gel electrophoresis to separate protein variants

  • Glycan analysis for glycoproteins

  • Circular dichroism to assess secondary structure changes

For recombinant therapeutic proteins produced in CHO cells, ensuring proper glycosylation patterns that mimic human glycosylation is essential for efficacy and safety. Researchers should consider that while CHO cells can perform humanized glycosylation, there are still differences from human patterns that may need to be addressed for specific applications.

What are the indicators of ribosomal stress during recombinant protein expression?

Ribosomal stress during high-level recombinant protein expression can significantly impact protein quality and yield. Recognizing the signs of ribosomal stress allows researchers to adjust expression conditions and optimize protein production.

Common indicators of ribosomal stress include:

Ribosomes traditionally considered as mere deciphers of the genetic code also shape the transcriptome by controlling mRNA stability . During recombinant protein production, the codon bias of the gene and the expression system affect expression rate, yield, and product quality . When certain codons cause ribosome pausing due to low tRNA availability, it can trigger ribosomal stress responses.

What experimental design considerations optimize induction timing and conditions?

Optimizing induction timing and conditions is critical for maximizing recombinant protein yield while maintaining protein quality and cell viability. A systematic experimental approach should consider multiple factors:

  • Growth phase for induction: For E. coli expression systems, induction at mid-log phase (OD600 0.4-0.8) typically yields optimal results, balancing biomass accumulation with metabolic capacity.

  • Inducer concentration optimization: For IPTG-inducible systems, testing concentrations between 0.1-1.0 mM is recommended. Note that dose-dependent expression when using IPTG is not always predictable since IPTG can enter the cell by active transport through the Lac permease or by permease-independent pathways .

  • Alternative induction systems: For more predictable dose-dependent expression, consider L-rhamnose inducible systems. When using the rhaP BAD promoter, trials with L-rhamnose concentrations from 0 to 2,000 μM should be conducted to find optimal expression conditions .

  • Temperature considerations: Post-induction temperature affects protein folding and solubility. Lower temperatures (15-25°C) often improve solubility by slowing expression rate, allowing more time for proper folding.

  • Induction duration: Determine optimal harvest time through time-course experiments, as extended expression periods may lead to protein degradation or cell death.

How can fusion tags be leveraged to enhance recombinant protein purification?

Fusion tags represent powerful tools for improving both the expression and purification of recombinant proteins. Beyond traditional affinity tags, stimulus-responsive tags offer innovative purification approaches.

Advanced fusion tag technologies include:

  • β-roll tags: These tags allow for selective precipitation of the recombinant protein in the presence of calcium. This approach yields high-purity products and the precipitation protocol takes only a few minutes .

  • Elastin-like polypeptides (ELPs): Consisting of tandem repeats of the sequence VPGXG (where X is Val, Ala, or Gly in a 5:2:3 ratio), these tags undergo an inverse phase transition at a given temperature . This property enables temperature-based purification without chromatography.

  • Split-intein tags: These enable seamless protein purification through protein trans-splicing, leaving no remnant of the tag in the final product.

The methodological workflow for purification using stimulus-responsive tags typically involves:

  • Expression of the fusion protein

  • Cell lysis and clarification

  • Application of the specific stimulus (temperature change, addition of calcium, etc.)

  • Collection of the precipitated protein

  • Removal of the tag if necessary (through protease cleavage or intein splicing)

This approach offers advantages including reduced purification time, lower costs by eliminating chromatography steps, and potential for higher yields through more efficient recovery.

What advances in CHO cell engineering are improving difficult-to-express proteins?

Chinese Hamster Ovary (CHO) cells have become the predominant expression system for therapeutic proteins, yet some proteins remain difficult-to-express (DTE). Recent advances in CHO cell engineering are addressing these challenges through multiple approaches.

Key strategies for improving expression of DTE proteins include:

  • Cell viability enhancement: Genetic modifications targeting anti-apoptotic pathways can extend culture duration and improve yields.

  • Transcription factor engineering: Overexpression of transcription factors such as ZFP-TF, ATF4, or GADD34 has been shown to increase recombinant protein yields up to 10-fold compared to parental cells .

  • mTOR pathway modulation: The mammalian target of rapamycin (mTOR) plays a crucial role in protein biosynthesis. Enhanced expression of the mTOR gene significantly improves cell growth (increased cell size and protein content), proliferation (increased cell cycle progression), viability (decreased apoptosis), and robustness (decreased sensitivity to suboptimal growth factors and oxygen supply) .

  • Sequence optimization beyond codons: Beyond codon optimization, researchers now consider:

    • GC content adjustment

    • Elimination of repetitive sequences

    • Removal of restriction enzyme recognition sites

    • Avoidance of RNA motifs that interfere with mRNA processing

    • Optimization of 5' untranslated regions (5' UTRs)

  • Protein sequence engineering: For monoclonal antibodies, modifying sequence motifs such as complementarity determining region three can influence the rate of light chain-heavy chain dimerization during antibody synthesis, resulting in product-specific yield differences .

These advanced approaches demonstrate that overcoming DTE protein challenges requires comprehensive engineering at multiple levels—from gene sequence to cellular processes and protein structure.

What emerging technologies are expanding the capabilities of recombinant protein expression?

Recombinant protein expression technology continues to evolve rapidly, with several emerging approaches poised to overcome current limitations and expand research capabilities.

Promising emerging technologies include:

  • Cell-free protein synthesis: These systems bypass cellular constraints by using purified components of the transcription/translation machinery, enabling expression of toxic proteins and rapid protein production.

  • Non-canonical amino acid incorporation: Expansion of the genetic code to incorporate non-standard amino acids creates proteins with novel properties for research and therapeutic applications.

  • Glycoengineering: Precise control of glycosylation patterns through cell line engineering and process optimization improves therapeutic protein efficacy and consistency.

  • Machine learning approaches: Computational predictions of optimal expression conditions, codon usage, and sequence modifications are accelerating optimization processes.

  • Continuous processing: Moving from batch to continuous bioprocessing improves efficiency and consistency in large-scale protein production.

Looking ahead, the integration of these technologies with advances in synthetic biology and computational design promises to further transform recombinant protein research, enabling expression of increasingly complex proteins with precisely controlled characteristics and functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.