Recombinant Protein traX (traX)

Shipped with Ice Packs
In Stock

Description

Functional Properties of Recombinant TRAX

TRAX exhibits remarkable functional versatility, participating in multiple cellular pathways through interactions with various partner proteins. Its functions range from nucleic acid binding and processing to roles in complex cellular processes such as RNA silencing, synaptic plasticity, and DNA repair.

Nucleic Acid Binding Properties

Comparative studies of recombinant translin and the translin-TRAX complex have revealed distinct nucleic acid binding preferences. While translin alone preferentially binds to G-rich RNA sequences, the translin-TRAX complex exhibits enhanced affinity for G-rich DNA sequences . This differential binding pattern suggests a regulatory role for TRAX in modulating translin's nucleic acid binding specificity.

Binding studies have demonstrated that:

  • Translin can bind mRNA sequences with sub-micromolar Kd values

  • The translin-TRAX complex binds G-rich DNA with comparable affinity

These findings indicate that TRAX acts as a regulatory factor that modulates translin's RNA and DNA binding affinities, potentially as part of cellular RNA trafficking mechanisms .

Role in RNA Silencing

TRAX functions in combination with translin (TSN) as an endonuclease involved in the activation of the RNA-induced silencing complex (RISC) . Together, they form the C3PO complex, which possesses endoribonuclease activity that cleaves target RNAs, leaving 3′ hydroxyl-cleaved ends .

The catalytic activity of TRAX within this complex is essential for microRNA-mediated gene regulation. The translin/TRAX RNase complex degrades specific microRNAs, thereby reversing microRNA-mediated translational silencing to trigger protein synthesis critical for cellular processes such as synaptic plasticity .

DNA Repair Function

Recent studies have revealed that TRAX plays a significant role in DNA repair pathways independent of its interaction with translin . TRAX can bind to and activate ATM (Ataxia Telangiectasia Mutated), a central component of the double-stranded DNA break repair process . This finding represents a paradigm shift in understanding TRAX function, as it demonstrates that TRAX can operate independently of translin in specific cellular contexts.

This dual functionality—working with translin in RNA silencing and independently in DNA repair—establishes TRAX as a versatile signaling protein with multiple partner interactions across diverse cellular pathways .

Production of Recombinant TRAX Protein

Recombinant TRAX proteins are produced using various expression systems and purification strategies to obtain functionally active protein for research and biochemical studies.

Expression Systems

Recombinant human TRAX protein is commonly expressed in:

  1. Escherichia coli bacterial expression systems

  2. HEK293T mammalian cell expression systems

The choice of expression system depends on the specific research requirements, with each system offering distinct advantages:

  • E. coli systems typically yield higher protein quantities but may lack post-translational modifications

  • Mammalian expression systems like HEK293T can provide proteins with native-like post-translational modifications

Fusion Tags and Purification

Commercial recombinant TRAX proteins are available with various fusion tags to facilitate purification and detection:

Tag TypePositionExpression SystemSource
His6N-terminalE. coliAbcam
His6-ABPN-terminalE. coliNovus Biologicals
C-Myc/DDKC-terminalHEK293TBoster Biological

These tags enable efficient purification using affinity chromatography techniques. For instance, His-tagged TRAX is typically purified using immobilized metal affinity chromatography (IMAC) . The purity of commercially available recombinant TRAX proteins generally ranges from >80% to >90% .

Biochemical Properties of Recombinant TRAX

The biochemical properties of recombinant TRAX have been extensively characterized to understand its function and interactions.

Enzymatic Activity

The endoribonuclease activity of TRAX is a critical aspect of its function in RNA silencing. When complexed with translin to form C3PO, it exhibits robust enzymatic activity, cleaving near stoichiometric amounts of substrate per second . This activity depends on the presence of the acidic triad (Glu123, Glu126, and Asp204), which likely coordinates Mg²⁺ ions required for RNA phosphodiester bond hydrolysis .

Mutation studies have shown that altering any of these three acidic residues to alanine abolishes both the RNA endonuclease activity and the RISC enhancer activity of the complex . This finding highlights the central role of TRAX's catalytic center in its function.

Protein-Protein Interactions

TRAX engages in multiple protein-protein interactions that dictate its cellular functions:

  1. Interaction with translin to form the C3PO complex involved in RNA silencing

  2. Binding to ATM to promote DNA repair pathways

  3. Potential interactions with other cellular proteins that remain to be fully characterized

These interactions reflect the versatility of TRAX as a signaling hub that participates in diverse cellular processes. Notably, while earlier studies suggested that TRAX was unstable in the absence of translin, recent findings indicate that it can function independently in certain contexts, such as DNA repair .

Post-translational Modifications

TRAX undergoes sumoylation with SUMO1, a post-translational modification that may regulate its function or localization . The specific roles of this modification in TRAX activity remain an area of active investigation.

Applications in Research

Recombinant TRAX protein serves as a valuable tool for various research applications in molecular biology and biochemistry.

Functional Assays

Recombinant TRAX is employed in functional assays to investigate:

  • RNA and DNA binding properties

  • Endonuclease activity

  • Protein-protein interactions

  • Effects on RISC activation and function

Such assays have contributed significantly to our understanding of TRAX's roles in RNA silencing and DNA repair pathways.

Antibody Production and Validation

Recombinant TRAX protein serves as an antigen for antibody production and as a blocking agent for antibody validation . These antibodies are essential research tools for detecting and studying endogenous TRAX in cellular contexts.

Future Research Directions

Understanding the multiple functions of TRAX across different cellular contexts presents exciting opportunities for future research. Key areas of investigation include:

  1. The molecular mechanisms governing TRAX's dual functionality in RNA silencing and DNA repair

  2. The regulatory mechanisms that direct TRAX to different cellular compartments and functional pathways

  3. The potential role of TRAX in disease states and therapeutic applications

Continued characterization of recombinant TRAX proteins with enhanced purity and activity will be crucial for advancing these research directions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on your purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is decided during production. If you have a preference for a particular tag type, please inform us. We will prioritize developing your desired tag if feasible.
Synonyms
traX; Protein TraX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Escherichia coli
Target Names
traX
Target Protein Sequence
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWM FLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAF AVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLMLAVSYRLYRAEDRAERL ALLACLLAVIPALNLASSDAAAVAGLVMTVLTVGLVSCAGKSLPRFWPGDFFPVFYACHL AVLGVLAL
Uniprot No.

Target Background

Function
This protein plays a crucial role in the N-terminal acetylation of F pilin.
Protein Families
TraX family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TRAX protein and what is its primary function in cellular biology?

TRAX (Translin-associated protein X, also known as TSNAX) is a 290 amino acid protein that was first identified as an interaction partner of translin . It belongs to the translin family and forms a heteromeric complex with translin that functions as an RNase . This complex plays a crucial role in microRNA degradation, which impacts various downstream cellular processes .

The primary functions of TRAX include:

  • Acting as an endonuclease when complexed with TSN (translin) in the RNA-induced silencing complex (RISC)

  • Participating in synaptic plasticity pathways by regulating microRNA-mediated translational silencing

  • Playing a role in DNA repair signaling, particularly in double-stranded DNA break repair

  • Potentially contributing to spermatogenesis, though this role requires further investigation

Methodologically, researchers studying TRAX's basic functions typically employ protein-protein interaction assays (such as co-immunoprecipitation), RNase activity assays, and cellular localization studies using fluorescently tagged TRAX constructs to elucidate its distribution and movement within cells.

How does TRAX interact with translin and other partner proteins?

The interaction between TRAX and translin creates a functional RNase complex capable of cleaving specific microRNAs, particularly those with mismatches in their stems . Beyond translin, TRAX has been found to interact with ATM (ataxia telangiectasia mutated), a central component in the double-stranded DNA repair process .

To study these interactions, researchers commonly employ:

  • Yeast two-hybrid screening to identify novel interaction partners

  • Co-immunoprecipitation followed by mass spectrometry to confirm interactions in cellular contexts

  • Structural studies using X-ray crystallography or cryo-EM to determine binding interfaces

  • Mutational analysis to identify critical residues involved in protein-protein interactions

What expression systems are used to produce recombinant TRAX protein for research?

Recombinant TRAX protein is commonly produced in bacterial expression systems, particularly Escherichia coli . Commercial preparations of recombinant human TRAX protein typically span the full-length sequence (amino acids 1-290) and include purification tags such as hexahistidine (His-tag) .

The typical production workflow involves:

  • Cloning the TRAX coding sequence into an appropriate expression vector

  • Transforming the construct into a bacterial expression strain optimized for protein production

  • Inducing protein expression under controlled conditions

  • Cell lysis and protein extraction

  • Affinity purification using the fusion tag (commonly His-tag)

  • Quality control assessment (SDS-PAGE, mass spectrometry)

For applications requiring higher eukaryotic post-translational modifications, researchers may opt for insect cell (baculovirus) or mammalian cell expression systems, particularly when studying TRAX sumoylation with SUMO1, which has been identified as an important modification .

How can researchers differentiate between TRAX's dual roles in microRNA regulation and DNA repair pathways?

Differentiating between TRAX's role in microRNA regulation versus DNA repair requires careful experimental design. These distinct functions appear to involve different molecular mechanisms and partner proteins - TRAX partners with translin for microRNA degradation but operates independently of translin in DNA repair .

Methodological approach:

  • Protein complex analysis: Use size-exclusion chromatography or density gradient centrifugation to separate TRAX-translin complexes from TRAX-ATM complexes, followed by functional assays specific to each pathway.

  • Domain-specific mutations: Design mutations that selectively disrupt one interaction while preserving the other. For example:

    • Mutations disrupting TRAX-translin interaction to study isolated DNA repair functions

    • Mutations affecting ATM binding while preserving translin interaction

  • Temporal regulation analysis: Monitor TRAX localization and complex formation following specific stimuli:

    • DNA damage induction (e.g., gamma irradiation) to activate repair pathways

    • Synaptic stimulation protocols to activate plasticity-related processes

  • Pathway-specific readouts: Employ distinct functional assays:

    • microRNA degradation assays using labeled pre-miRNAs

    • DNA repair efficiency measurements using comet assays or γH2AX foci quantification

PathwayPartner ProteinCellular LocalizationActivation SignalFunctional Readout
microRNA regulationTranslinPrimarily cytoplasmicSynaptic activityReduced microRNA levels; increased translation of target mRNAs
DNA repairATMNuclear translocation upon damageDouble-strand breaksATM phosphorylation; γH2AX foci formation

What experimental controls are essential when studying TRAX function in synaptic plasticity models?

When investigating TRAX's role in synaptic plasticity, particularly in the context of microRNA degradation and translational control, several critical controls must be incorporated:

  • Protein expression controls:

    • Validate TRAX and translin expression levels across experimental conditions

    • Include translin knockout controls to differentiate TRAX-specific effects from translin/TRAX complex effects

    • Use catalytically inactive TRAX mutants to confirm RNase activity dependence

  • Stimulus specificity controls:

    • Compare multiple plasticity induction protocols (e.g., high-frequency stimulation vs. theta-burst stimulation)

    • Include non-potentiating stimulation controls

    • Temporal analysis of TRAX activation relative to stimulation

  • microRNA specificity controls:

    • Measure levels of TRAX-sensitive and TRAX-insensitive microRNAs

    • Include microRNAs regulated by other degradation pathways (e.g., Lin-28a/let-7 pathway) as specificity controls

    • Use microRNA mimics and inhibitors to rescue phenotypes

  • Downstream validation:

    • Confirm translation of known target mRNAs using techniques like polysome profiling or TRAP (translating ribosome affinity purification)

    • Include pharmacological controls (translation inhibitors like cycloheximide; mTOR inhibitors)

    • Combine electrophysiological measurements with molecular readouts

A crucial aspect of experimental design is the incorporation of appropriate randomization techniques to minimize bias. Proper randomization ensures that observed effects are attributable to the manipulated variables rather than to pre-existing differences or selection bias .

What considerations should guide experimental design when studying recombinant TRAX protein activity in vitro?

When designing experiments to study recombinant TRAX protein activity in vitro, researchers should consider several critical factors:

  • Protein preparation considerations:

    • Evaluate the impact of purification tags on activity (His-tags may affect function in some assays)

    • Assess protein folding and structural integrity using circular dichroism or thermal shift assays

    • Confirm complex formation with translin when studying RNase activity

    • Test protein stability under various buffer conditions and temperatures

  • Activity assay design:

    • For RNase activity, use defined substrate pre-microRNAs with known stem mismatches

    • Include positive controls (commercial RNases) and negative controls (heat-inactivated TRAX)

    • Implement dose-response experiments with varying protein:substrate ratios

    • Evaluate cofactor requirements (divalent cations, ATP, etc.)

  • Experimental design principles:

    • Follow true experimental research design principles with appropriate controls

    • Implement randomization to control for extraneous variables

    • Define independent variables (e.g., TRAX concentration, substrate type) and dependent variables (e.g., cleavage efficiency)

    • Control for confounding variables such as temperature fluctuations or buffer composition

  • Data analysis approaches:

    • Employ appropriate statistical methods for analyzing enzymatic activity data

    • Consider kinetic modeling to determine reaction parameters (Km, Vmax)

    • Use multiple technical and biological replicates to ensure reproducibility

TRAX activity exhibits substrate specificity, particularly for pre-microRNAs with mismatches in their stems . Researchers should design experiments that compare structurally diverse RNA substrates to characterize this specificity in detail.

How can researchers address the stability issues of TRAX protein in experimental systems?

Early research suggested that TRAX protein is unstable in cells lacking translin . This presents a significant challenge for researchers studying TRAX-specific functions independent of translin. Several methodological approaches can address this challenge:

  • Stabilization strategies:

    • Co-express minimum domains of translin required for TRAX stabilization without conferring full translin functionality

    • Develop conditionally stable TRAX variants using destabilizing domain technology

    • Use proteasome inhibitors to prevent degradation of TRAX in translin-depleted conditions

    • Identify and mutate degrons within TRAX that govern its stability

  • Expression system optimization:

    • Test multiple cell types that may have varying levels of endogenous translin

    • Utilize inducible expression systems with tight regulation to achieve desired expression windows

    • Explore tissue-specific expression patterns to identify naturally translin-low/TRAX-high contexts

  • Analytical considerations:

    • Implement pulse-chase experiments to measure TRAX half-life under various conditions

    • Use quantitative Western blotting with recombinant protein standards for accurate quantification

    • Develop sensitive detection methods for low-abundance TRAX (targeted mass spectrometry)

  • Experimental timing:

    • Design experiments with careful consideration of time points following translin depletion

    • Implement rapid protein depletion methods (e.g., auxin-inducible degron systems) for acute removal of translin

Recent findings challenging the exclusive TRAX-translin interaction model indicate that TRAX can function independently in certain contexts, particularly in DNA repair pathways . Researchers should leverage these insights to develop experimental systems that allow study of these independent functions.

What methodological approaches can resolve contradictory findings regarding TRAX function across different experimental systems?

The literature on TRAX reveals some apparently contradictory findings about its function, particularly regarding its dependence on translin and its involvement in different cellular pathways . Resolving these contradictions requires sophisticated experimental approaches:

  • System-specific investigations:

    • Compare TRAX function across multiple cell types (neurons, fibroblasts, immune cells)

    • Investigate developmental timing effects (embryonic vs. adult systems)

    • Examine species-specific differences using orthologous proteins from multiple organisms

    • Test pathway activity in different subcellular compartments (nucleus vs. cytoplasm)

  • Context-dependent activation:

    • Characterize post-translational modifications that may switch TRAX function (e.g., SUMO1 modification)

    • Investigate stimuli that might shift TRAX between different complexes or pathways

    • Examine dose-dependent effects where low vs. high expression levels may engage different pathways

  • Advanced experimental design approaches:

    • Implement factorial experimental designs to test multiple variables simultaneously

    • Use randomized controlled experimental designs to minimize bias

    • Develop mathematical models that incorporate dual or context-dependent functions

    • Employ systems biology approaches to map TRAX in interaction networks

  • Technical reconciliation strategies:

    • Standardize protein preparation methods across laboratories

    • Develop common activity assays that can be reproduced between research groups

    • Create detailed protocols for specific applications (synaptic plasticity models vs. DNA repair assays)

Controversial AspectContradictory FindingsReconciliation Approach
TRAX stability without translinSome studies show instability; others show independent functionTest stability across different cell types and conditions; examine tissue-specific factors
Primary function (microRNA regulation vs. DNA repair)Evidence supports both functions as importantInvestigate context-dependent switching mechanisms and temporal regulation
Partner protein interactionsSome studies focus exclusively on translin; others show multiple partnersComprehensive interactome analysis using proximity labeling or mass spectrometry
RNase activity requirementsVarying reports on substrate specificityStandardized in vitro assays with defined substrates; structural studies of substrate binding

What are the optimal conditions for preserving recombinant TRAX protein activity during experimental procedures?

Working with recombinant TRAX protein requires careful attention to storage and handling conditions to maintain its functional activity. Based on standard practices for similar proteins:

  • Storage considerations:

    • Store purified recombinant TRAX at -80°C in small aliquots to avoid repeated freeze-thaw cycles

    • Include cryoprotectants such as glycerol (typically 10-20%) in storage buffers

    • Consider lyophilization for long-term stability if compatible with downstream applications

    • Monitor protein degradation regularly using SDS-PAGE

  • Buffer composition factors:

    • Maintain pH stability (typically pH 7.4-8.0 for recombinant proteins)

    • Include reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

    • Add protease inhibitors to prevent degradation

    • Test EDTA effects carefully, as some RNase activities require divalent cations

  • Activity preservation strategies:

    • For RNase activity assays, ensure RNase-free conditions throughout experimental procedures

    • When studying TRAX-translin complexes, pre-form complexes before freezing if possible

    • Validate activity after each significant purification or handling step

    • Consider carrier proteins (BSA) for very dilute solutions

  • Quality control approaches:

    • Implement routine activity assays to verify functional integrity

    • Use thermal shift assays to monitor protein stability

    • Consider native PAGE or size exclusion chromatography to confirm proper oligomeric state

    • Validate protein identity periodically through mass spectrometry

The 290 amino acid human TRAX protein with a His-tag has been successfully expressed in E. coli and maintained at >90% purity , suggesting that bacterial expression systems can produce functional protein when appropriate handling procedures are followed.

How can researchers effectively analyze TRAX's dual functions in cellular models?

Analyzing TRAX's multiple functions in cellular contexts requires sophisticated experimental design that can distinguish between its roles in microRNA regulation and DNA repair. Researchers should consider:

  • Cellular compartmentalization analysis:

    • Implement fractionation protocols to separate nuclear and cytoplasmic pools of TRAX

    • Use fluorescent protein fusions with appropriate controls to track TRAX localization dynamically

    • Employ proximity ligation assays to detect TRAX-partner interactions in specific compartments

    • Develop compartment-specific activity assays (nuclear DNA repair vs. cytoplasmic RNA processing)

  • Pathway-specific activation:

    • Design stimulation protocols that selectively activate DNA repair (radiomimetic drugs, UV irradiation)

    • Implement protocols for inducing synaptic plasticity in neuronal models

    • Use chemogenetic approaches to activate specific pathways with temporal control

    • Measure downstream effectors specific to each pathway (phosphorylated ATM vs. microRNA levels)

  • Genetic manipulation strategies:

    • Develop domain-specific mutations that selectively impair one function while preserving others

    • Implement inducible knockdown/knockout systems with rescue experiments

    • Use CRISPR-based approaches for endogenous tagging and regulation

    • Consider translin knockout backgrounds to isolate translin-independent functions

  • Integrated analysis approaches:

    • Combine multiple assay readouts within the same experimental system

    • Implement temporal analysis to determine sequential activation of different pathways

    • Correlate biochemical measurements with functional outcomes

    • Use computational modeling to integrate diverse datasets

These approaches align with the principles of robust experimental design, including the careful identification of independent and dependent variables, control of extraneous variables, and implementation of appropriate randomization techniques .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.