Recombinant Protein unc-1 (unc-1)

Shipped with Ice Packs
In Stock

Description

General Information

The unc-1 gene encodes for protein UNC-1 in Caenorhabditis elegans and is involved in locomotion control . Studies indicate that UNC-1, along with UNC-9, primarily functions in neurons to regulate movement in nematodes .

Expression and Purification

Recombinant protein production allows for the generation of large quantities of a specific protein for research purposes . For example, the C. elegans UNC-18 protein, implicated in vesicle targeting, docking, and/or fusion, was expressed in Spodoptera frugiperda Sf21 cells using a baculovirus expressing system to produce high levels of the protein for further study . The recombinant virus produced a 67 kDa protein, which constituted about one-third of the total cell protein . The UNC-18 protein was then purified, and its biochemical and functional properties were assessed .

Implications in Other Proteins

  • UCP-1 Studies Recombinant uncoupling protein-1 (UCP-1) has been studied using circular dichroism (CD) spectroscopy to understand its structure and function . Both recombinant, untagged mouse UCP-1 and a hexahistidine-tagged version were produced in high purity following overexpression in Escherichia coli . CD spectroscopy revealed that both recombinant UCP-1 proteins are dominantly helical (40–50%) in digitonin micelles .

  • USP1/UAF1 as Anticancer Target The deubiquitinating enzyme USP1, in association with UAF1, is a regulator of DNA damage response and has been identified as a potential anticancer target . High-throughput screening and medicinal chemistry optimization led to the identification of potent USP1/UAF1 inhibitors, which exhibited anticancer activity against nonsmall cell lung cancer cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
unc-1; K03E6.5; Protein unc-1; Uncoordinated protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
unc-1
Target Protein Sequence
MSNKERTEPQWVTPSSNQDVPPDYETIGTIFGYALQALSWILIIVTFPFSMCVCLKVIKE YERVVIFRIGRLVFGGARGPGMIFIIPCIDTYRKIDLRVVSYAVPPQEILSKDSVTVSVD AVVYFRTSDPIASVNNVDDAIYSTKLLAQTTLRNALGMKTLTEMLTEREAIAQLCETILD EGTEHWGVKVERVEVKDIRLPQQLTRAMAAEAEAAREARAKVVAAEGEQKASRALKEAAD VIQANPVALQLRHLQALNSIAAEHNSTIVFPVPVEMFGAFMKKDQ
Uniprot No.

Target Background

Gene References Into Functions
The following studies provide insights into UNC-1 function:
  1. Mutations in the unc-24 gene affect UNC-1 distribution in lipid rafts. [PMID: 15102610](https://www.ncbi.nlm.nih.gov/pubmed/15102610)
  2. Homologs of Hyperkinetic and K channel regulator 1 proteins interact with and modify unc-103 function; mutations impact function and physiology. [PMID: 15280551](https://www.ncbi.nlm.nih.gov/pubmed/15280551)
  3. Targeted rescue experiments indicate that UNC-9 and UNC-1 primarily function in neurons to regulate locomotion. [PMID: 17658257](https://www.ncbi.nlm.nih.gov/pubmed/17658257)
Database Links

KEGG: cel:CELE_K03E6.5

STRING: 6239.K03E6.5b

UniGene: Cel.23065

Protein Families
Band 7/mec-2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Netrin-1 and how does it relate to UNC proteins?

Netrin-1 is a secreted protein that functions as a guidance cue in neuronal development. Its effects are controlled through different transmembrane receptors, including those in the UNC family. Four of these receptors exist in the UNC-5 (UNC = uncontrolled behaviorally) family of proteins: UNC5h1, UNC5h2, UNC5h3/RCM, and UNC5h4. There are also two receptors in the UNC-40 family: DCC (deleted in colorectal cancer) and neogenin (newly-generated) . The UNC-5 receptors primarily mediate repulsion responses to netrin, while UNC-40/DCC mediates attraction. When co-expressed with DCC in the presence of Netrin-1, UNC-5 molecules mediate repulsion by altering cellular calcium levels .

What are the key structural features of recombinant Netrin-1 protein?

Recombinant human Netrin-1 protein typically includes amino acids Val22-Ala604 (accession # O95631) with potential modifications like a C-terminal polyhistidine tag for purification purposes. The protein is commonly formulated as a lyophilized powder from a filtered solution in PBS and EDTA, either with BSA as a carrier protein or in carrier-free form . The recombinant protein maintains the functional domains required for receptor binding and cellular signaling.

How do Netrin-1 and UNC receptors function as a signaling system?

Netrin-1 and its receptors (UNC-5 and DCC family proteins) constitute a "dependence receptor" system. These receptors depend on Netrin-1 for survival; when unbound, they induce specific death signals . This system plays a critical role in:

  • Axon guidance during neural development

  • Cell migration and adhesion

  • Tissue morphogenesis

  • Apoptosis regulation

  • Tumor biology through initiation or inhibition of apoptosis

The dysregulation of this receptor system has important implications in tumor development and progression .

What experimental methods are most effective for studying Netrin-1 interactions with UNC receptors?

For investigating Netrin-1/UNC receptor interactions, researchers should consider these methodological approaches:

  • Cell Proliferation Assays: RT4-D6P2T rat schwannoma cells are commonly used with an ED50 of 0.5-2.0 μg/mL of recombinant Netrin-1 .

  • Neurite Outgrowth Assays: FANCC proteins have been found to localize with UNC5A during neurite outgrowth, making this a valuable model for studying UNC receptor function .

  • Migration Assays: Particularly useful for studying Neogenin-expressing melanoma cells' response to Netrin-1 .

  • Co-immunoprecipitation: For direct protein-protein interaction studies between Netrin-1 and its receptors.

  • Calcium Imaging: To measure calcium flux in response to Netrin-1/UNC-5/DCC signaling.

These methods should be selected based on the specific research question and cellular context being studied.

How can researchers effectively investigate the role of Netrin-1/UNC signaling in disease models?

Research into Netrin-1/UNC signaling in disease models should employ multifaceted approaches:

  • Cancer Models: Neogenin-expressing aggressive melanoma cells show significant migration response to Netrin-1 stimulation, making them excellent in vitro models . Loss of NECTIN1 triggers melanoma dissemination upon local IGF1 depletion, highlighting the complex interplay in signaling pathways .

  • Neurological Disease Models: Intranasal administration of recombinant Netrin-1 attenuates neuronal apoptosis by activating DCC/APPL-1/AKT signaling after subarachnoid hemorrhage in rats .

  • Metabolic Disorders: Netrin-1 promotes visceral adipose tissue inflammation in obesity and is associated with insulin resistance .

  • Vascular Disorders: Downregulation of UNC5b receptor underlies increased placental angiogenesis in human gestational diabetes mellitus .

Researchers should select appropriate models based on their specific disease focus, considering both in vitro cellular systems and in vivo animal models.

What are the key methodological considerations for producing functional recombinant UNC receptor proteins?

Production of functional recombinant UNC receptor proteins requires careful consideration of:

  • Expression Systems: E. coli systems can be effective for producing recombinant proteins, but mammalian expression systems may better preserve post-translational modifications critical to UNC receptor function .

  • Protein Conformation: Like other membrane proteins, UNC receptors require proper folding. CD spectroscopy can confirm proper secondary structure, similar to how it's used for UCP-1 to verify helical content (40-50%) in detergent micelles .

  • Functional Validation: Ligand binding assays (using recombinant Netrin-1) should confirm receptor functionality, potentially detectable in the near-UV CD region as demonstrated for nucleotide binding to UCP-1 .

  • Solubilization Methods: For transmembrane proteins like UNC receptors, careful selection of detergents is critical; digitonin has proven effective for maintaining helical conformations in similar membrane proteins .

  • Optimization Strategy: Design of Experiments (DoE) approaches should be employed rather than inefficient one-factor-at-a-time methods to identify optimal expression and purification conditions .

What is the optimal protocol for reconstituting lyophilized recombinant Netrin-1 protein?

For optimal reconstitution of lyophilized recombinant Netrin-1:

  • Reconstitution Concentration: Reconstitute at 100 μg/mL in PBS for both carrier-containing and carrier-free formulations .

  • Storage Considerations: Upon receipt, store immediately at recommended temperatures. Use a manual defrost freezer and avoid repeated freeze-thaw cycles to maintain protein integrity .

  • BSA Considerations:

    • For cell/tissue culture or ELISA standards, use the BSA-containing formulation

    • For applications where BSA might interfere, use the carrier-free (CF) version

  • Functional Verification: After reconstitution, verify activity using a cell proliferation assay with RT4-D6P2T rat schwannoma cells, where functional Netrin-1 should show an ED50 of 0.5-2.0 μg/mL .

How can researchers apply Design of Experiments (DoE) to optimize recombinant protein expression?

Implementation of DoE for optimizing recombinant protein expression follows these methodological steps:

  • Selection of Experimental Factors: Identify key variables affecting protein expression, such as:

    • Induction temperature

    • Inducer concentration

    • Expression time

    • Media composition

    • Host strain

  • DoE Approach Selection: Choose between factorial designs, response surface methodology, or Taguchi methods based on the number of factors and research objectives .

  • Experiment Design: Use statistical software to generate a minimal set of experiments that will provide maximum information about factor effects and interactions .

  • Response Measurement: Quantify protein yield and activity as response variables.

  • Statistical Analysis: Analyze results to determine optimal conditions and significant factors.

This approach is superior to the one-factor-at-a-time method as it accounts for interactions between factors and requires fewer experiments to reach optimal conditions .

What techniques are most effective for assessing the functional activity of recombinant Netrin-1 protein?

To assess functional activity of recombinant Netrin-1, consider these validated approaches:

  • Cell Proliferation Assays: Using RT4-D6P2T rat schwannoma cells with an expected ED50 of 0.5-2.0 μg/mL for functional protein .

  • Migration Assays: Particularly valuable with neogenin-expressing melanoma cells that show chemotactic responses to Netrin-1 .

  • Neurite Outgrowth Analysis: Measuring neurite extension in neuronal cells in response to Netrin-1 gradients.

  • Receptor Binding Assays: Using surface plasmon resonance or similar techniques to measure direct binding to purified DCC or UNC5 receptors.

  • In Vivo Models: For advanced validation, intranasal administration in rat models of subarachnoid hemorrhage has demonstrated Netrin-1's ability to attenuate neuronal apoptosis through specific signaling pathways .

The selection of assays should align with the specific research question and downstream applications.

How should researchers interpret conflicting results in Netrin-1/UNC signaling experiments?

When facing contradictory results in Netrin-1/UNC signaling studies, consider these analytical approaches:

  • Receptor Context Dependency: The same Netrin-1 concentration can trigger attraction or repulsion depending on receptor expression patterns. Verify the expression profile of UNC-5 and DCC family receptors in your experimental system, as co-expression of these receptors can change signaling outcomes .

  • Calcium Signaling Verification: UNC-5 molecules, when co-expressed with DCC, mediate repulsion by altering cellular calcium levels. Measure calcium flux to confirm if this mechanism is active in your system .

  • Dependence Receptor Function: As dependence receptors, UNC and DCC proteins can trigger different pathways based on Netrin-1 concentration. At low concentrations, they may induce apoptosis, while at higher concentrations, they promote survival. Validate multiple Netrin-1 concentrations .

  • Cell-Type Specificity: Results from neuronal cells may differ from tumor cells due to different signaling contexts. The Netrin-1/UNC system has distinct functions in different tissues, including neuronal guidance, inflammation in adipose tissue, and tumor biology .

What are common pitfalls in recombinant protein experiments and how can they be avoided?

Researchers should be aware of these common pitfalls and mitigation strategies:

  • Protein Misfolding: Transmembrane and matrix-loop domains may adopt non-native conformations. Monitor protein conformation using CD spectroscopy to ensure proper secondary structure formation (expected 40-50% helical content in appropriate detergent environments) .

  • Suboptimal Reconstitution: Improper reconstitution can lead to protein aggregation or denaturation. Always follow recommended reconstitution protocols (100 μg/mL in PBS) and avoid freeze-thaw cycles .

  • Inefficient Experimental Design: One-factor-at-a-time approaches waste resources and miss interaction effects. Implement DoE approaches with carefully selected small sets of experiments to predict both individual factor effects and their interactions .

  • Carrier Protein Interference: BSA used as a carrier can interfere with certain applications. Choose carrier-free formulations when appropriate, especially for applications where BSA might affect results .

  • Irreversible Thermal Denaturation: Protein assemblies in detergent environments often show cooperative but irreversible thermal denaturation. Design experiments to avoid temperature conditions that might denature your protein .

What emerging technologies are advancing Netrin-1/UNC protein research?

Recent technological advances that are transforming Netrin-1/UNC research include:

  • CRISPR/Cas9 Genome Editing: Allows precise modification of Netrin-1 or UNC receptor genes to create improved cellular and animal models.

  • 3D Organoid Systems: Provides more physiologically relevant contexts for studying Netrin-1/UNC signaling in tissue development and disease.

  • Advanced Protein Engineering: Creation of modified Netrin-1 variants with enhanced stability, receptor specificity, or controlled release properties.

  • High-Throughput Screening Platforms: Combined with DoE approaches, these platforms accelerate the identification of optimal conditions for recombinant protein production and function .

  • Computational Modeling: Predicts protein-protein interactions and helps design experiments to test specific hypotheses about Netrin-1/UNC signaling.

Researchers should consider integrating these technologies into their experimental workflows to advance understanding of Netrin-1/UNC biology.

How are recombinant Netrin-1 proteins being applied in translational research?

Translational applications of recombinant Netrin-1 protein include:

  • Neuroprotection: Intranasal administration of recombinant Netrin-1 shows promise in attenuating neuronal apoptosis after subarachnoid hemorrhage by activating the DCC/APPL-1/AKT signaling pathway .

  • Cancer Therapeutics: Understanding Netrin-1's role as a survival factor for tumor cells through its dependence receptors has opened new therapeutic avenues. Recombinant proteins are being used to study potential interventions in this pathway .

  • Inflammatory Disorders: Netrin-1's role in visceral adipose tissue inflammation and insulin resistance suggests potential applications in metabolic disease research .

  • Regenerative Medicine: Netrin-1's effects on reinnervation of laryngeal muscles following recurrent laryngeal nerve injury indicate potential applications in nerve regeneration therapy .

  • Vascular Disorders: Recombinant Netrin-1 is being studied for its effects on angiogenesis in conditions like gestational diabetes .

These translational applications represent promising areas for further development of Netrin-1-based therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.