Recombinant Protein unc-50 (unc-50)

Shipped with Ice Packs
In Stock
Cat. No.
BT2118606
Source
in vitro E.coli expression system
Synonyms
unc-50; T07A5.2; Protein unc-50; Uncoordinated protein 50
Quick Inquiry

Description

Introduction to UNC50 and Recombinant Protein UNC-50

UNC50, the human homolog of the Caenorhabditis elegans unc-50 gene, is a conserved eukaryotic protein implicated in intracellular trafficking processes . Recombinant Protein UNC-50 refers to the genetically engineered form of this protein, produced in heterologous expression systems for functional and structural studies. This tool has become critical for investigating UNC50's roles in hepatocellular carcinoma (HCC) progression, epidermal growth factor receptor (EGFR) trafficking, and Shiga toxin dynamics .

Production and Purification Methods

Recombinant UNC50 is produced using diverse expression systems:

Expression HostTagPurityYieldKey Applications
HEK293T cells C-Myc/DDK>80%>50 µg/mLFunctional assays, co-IP
E. coli/Yeast N-/C-terminal tags>85%Lot-dependentStructural studies

Purification typically involves affinity chromatography (e.g., myc-tag systems) and validation via SDS-PAGE/Coomassie staining .

Role in Hepatocellular Carcinoma

  • EGFR Trafficking: UNC50 knockdown reduces cell surface EGFR levels by 40–60%, impairing G1/S transition and HCC cell proliferation .

  • Pathway Regulation: Downregulates CCND1, EGF, and MMP7 mRNA, key EGFR targets (p < 0.01 in Hep3B cells) .

Shiga Toxin Trafficking

  • CRISPR-edited ΔUNC50 cells show 70% reduction in Stx2 toxin uptake, confirming UNC50’s role in endosomal sorting .

Subcellular Localization

  • Fluorescence tagging localizes recombinant UNC50 to Golgi apparatus (AKR7A2 marker) and endoplasmic reticulum (calnexin 1 marker) .

Future Directions and Research Opportunities

  1. Mechanistic Studies: Clarify UNC50’s interaction with non-EGFR receptors (e.g., GPCRs) .

  2. Therapeutic Targeting: Explore UNC50 inhibition in HCC models using recombinant protein-based screens .

  3. Structural Biology: Resolve 3D conformation via cryo-EM using high-purity recombinant UNC50 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
unc-50; T07A5.2; Protein unc-50; Uncoordinated protein 50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
unc-50
Target Protein Sequence
MSSQPRGSGTQPGPSQSPISQRNFRYEPARSGYTSPGQYSTYSTSTADRVGCLTAVRMSA FAKLSRFTRRLVHIRQMDFEFALWQMLYLLIQPSKVYKNFIYRKRTKDQFARDDPAFLVL LALSLLFSSIFYAYALGLEKIGFFTFFLWSVFVDCIGVGVVIATVLWWVSNRFLRKVRDQ DVEWGYCFDVHLNAFFPMLILLHVIVPILYPTLIDSPAFLSILLGNTFWFLAACYYVYIT FLGYTALPILHKTQYFLYPISFIFMFFVATLTGGWNISRTALNFYHSRAEPHKFAPQHGG L
Uniprot No.
Q10045

Target Background

Function
Essential for cell surface expression of acetylcholine receptors in body-wall muscles.
Gene References Into Functions
  1. The transmembrane Golgi protein UNC-50 regulates nicotinic receptor trafficking. PMID: 17853888
Database Links

KEGG: cel:CELE_T07A5.2

STRING: 6239.T07A5.2

UniGene: Cel.22852

Protein Families
Unc-50 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.