Recombinant Protein yopB (yopB)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Protein YopB, commonly referred to as YopB, is a crucial component of the Type III secretion system (T3SS) in Yersinia species, including Y. pestis, Y. pseudotuberculosis, and Y. enterocolitica . The T3SS is essential for the virulence of Yersinia, enabling the bacteria to inject effector proteins into host cells, thereby evading host defenses . YopB is directly involved in the translocation of Yop effector proteins across the target cell plasma membrane .

2.1. Role in Translocation

YopB is essential for the formation of a pore in the target cell membrane, which facilitates the transfer of Yop effector proteins from the bacterium into the host cell . The N-terminal globular domain of LcrV is critical for the functional insertion of YopB into the host cell membrane .

2.2. Interaction with YopD

YopB interacts with another Yersinia outer protein, YopD . Co-expression of YopB and YopD has a stabilizing effect on both proteins, assisting in their correct folding by shielding hydrophobic domains from aqueous environments . When YopB and YopD are expressed together, neither protein is toxic to the cell, unlike when YopB is expressed alone .

2.3. Formation of the Translocon Complex

YopB and YopD form a translocon complex embedded in a nanolipoprotein particle (NLP), which provides a platform for protein interaction studies between pathogen and host proteins . The YopB/D complex can be rendered soluble with the addition of co-expressed NLP-forming components, increasing the yield of protein for biophysical studies .

3.1. Expression Systems

Recombinant YopB can be produced in E. coli cells using IPTG induction or auto-induction protocols . The auto-induction method generally yields a higher amount of protein .

3.2. Purification Methods

Purification of YopB often involves Ni affinity and size exclusion chromatography . When co-expressed with SycD and YopD, the purified protein may show bands corresponding to SycD, YopB, and YopD on SDS-PAGE, though not necessarily in stoichiometric ratios .

3.3. Enhancement of Solubility

The solubility of YopB can be enhanced through simultaneous expression with YopD and the addition of liposomes . The formation of a complex between YopB and YopD in a lipid environment may be indicative of the mechanism of translocon insertion into the host membrane .

4.1. Serodiagnosis of Yersiniosis

Recombinant YopB can be used as a highly specific antigen in enzyme-linked immunosorbent assays (ELISA) and recom-dot assays for the serodiagnosis of yersiniosis . Immunoglobulin G (IgG) antibodies to YopB have been observed in serum samples from individuals suspected of yersiniosis .

4.2. Comparison with Other Yops

In serodiagnostic assays, YopD has been found to be the most useful protein, with the most positive results obtained in ELISA with recombinant protein YopD . IgG antibodies to the protein V-Ag were more frequently observed than those to YopB and YopE .

5.1. Atomic Force Microscopy (AFM)

Atomic force microscopy can be used to confirm the formation of complexes between YopB and NLPs . YopB-NLPs and YopB/D-NLPs show populations with a significant height increase compared to "empty"-NLPs .

5.2. Protein-Protein Interactions

YopB interacts with host cell proteins, and studies of these interactions can help elucidate the mechanism by which Yersinia injects effector proteins into host cells .

Synthetic Binding Proteins (SBPs)

Synthetic binding proteins (SBPs) are artificially engineered proteins with targeted binding properties . The SYNBIP database provides information on SBPs, including their 3D structures, binding epitopes, and design methods . SBPs have lower molecular weights, are more stable and less immunogenic, and have better tissue penetration than classical antibodies .

7.1. Pore Formation

YopB is essential for YopB-dependent haemolytic activity, which requires cell contact between the bacteria and erythrocytes . The haemolytic activity can be inhibited by high molecular weight carbohydrates .

7.2. Reduction by YopE

Expression of another Yop protein, YopE, can reduce haemolytic activity .

8.1. Solubility of YopB and YopD with and without Liposomes

Protein(s) ExpressedLiposomes% Soluble YopB% Soluble YopD
YopBNo14.1N/A
YopDNoN/A33.4
YopB + YopDNo8.613.5
YopBYes15.2N/A
YopDYesN/A47.1
YopB + YopDYes17.617.1

8.2. AFM Analysis of YopB-NLPs and YopB/D-NLPs

SampleHeight Increase Compared to Empty NLPs
YopB-NLPsSignificant
YopB/D-NLPsIncreased

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Dry ice shipments incur additional charges and require prior arrangement.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag is required, please inform us to prioritize its inclusion in the manufacturing process.
Synonyms
yopB; pYV0055; Protein YopB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-401
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
yopB
Target Protein Sequence
MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVA SQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLASPDTFEIELGKLVSNLEEV RKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGIASKIFGWLSAIASVIVGA IMVASGVGAVAGAMMVASGVIGMANMAVKQAAEDGLISQEAMKILGPILTAIEVALTVVS TVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSAKVAQISTGISNTVGSAVTKLGGSF AGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKADMAALQSIID RLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPHTV
Uniprot No.

Target Background

Function
Involved in virulence.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YopB protein and what is its biological significance?

YopB is a bacterial protein found in Yersinia species including Y. enterocolitica and Y. pseudotuberculosis. It functions as a critical component of the Type III Secretion System (T3SS), forming pores in target cell membranes that are essential for the translocation of Yop effector proteins into host cells during infection. YopB is crucial for bacterial virulence, as demonstrated by studies showing that yopB mutant strains fail to elicit cytotoxic responses in cultured cells and are unable to inhibit phagocytosis by macrophage-like cells . The protein has membrane disruptive activity that enables the formation of pores in target cell membranes, which is required for the cell-to-cell transfer of Yop effector proteins . This pore-forming ability makes YopB an essential virulence factor in Yersinia pathogenesis.

What are the structural and molecular characteristics of recombinant YopB?

Recombinant YopB from Yersinia enterocolitica (O:9) produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain with a calculated molecular mass of approximately 43kDa . When expressed with an N-terminal His-tag, the protein typically retains its biological activity . The protein is often supplied in buffered solutions such as 20mM HEPES buffer (pH-7.6) with 250mM NaCl and 20% glycerol to maintain stability . In some recombinant forms, partial sequences of YopB are used, such as the 1-165aa region expressed with an N-terminal 6XHis-tag, resulting in a smaller theoretical molecular weight of 23.9kDa .

What expression systems are most effective for recombinant YopB production?

Multiple expression systems have been successfully employed for recombinant YopB production, each with distinct advantages:

Expression SystemAdvantagesConsiderationsReference
Sf9 Insect CellsGlycosylation capacity, higher protein folding fidelityMore complex, higher cost, longer production time
E. coliCost-effective, rapid production, simpler protocolsMay have folding issues with complex proteins, lacks post-translational modifications
Auto-inductionHigher protein yields, reduced monitoring requirementsRequires optimization of media composition
IPTG inductionPrecise control over induction timingGenerally lower yields compared to auto-induction for complex proteins

When expressing YopB, researchers should consider that expression of YopB alone can be toxic to host cells, whereas co-expression with partners such as YopD can reduce toxicity . For complex formation studies, co-expression of YopB with chaperones (e.g., SycD) and partner proteins (e.g., YopD) has been demonstrated using vectors like pET28a with N-terminal His tags .

What are effective purification strategies for recombinant YopB?

Purification of recombinant YopB typically involves a multi-step chromatography approach:

  • Initial capture using affinity chromatography: For His-tagged YopB, Ni-affinity chromatography is commonly employed as the first purification step .

  • Further purification using size exclusion chromatography: This step separates the target protein from aggregates and other contaminants based on molecular size .

  • Assessment of purity: SDS-PAGE analysis is used to verify purity, with successful purifications typically achieving >80-85% purity .

When purifying YopB-containing complexes (e.g., YopB-YopD-SycD), proteins may not express in stoichiometric ratios, requiring additional optimization. In one reported case, the ratio of SycD:YopB:YopD was approximately 4:1:2 , highlighting the challenges in obtaining homogeneous protein complexes for structural studies.

How should researchers design experiments to study YopB's pore-forming activity?

Designing robust experiments to study YopB's pore-forming activity requires careful consideration of multiple variables and appropriate controls:

  • Hemolytic assays: YopB-dependent hemolytic activity can be assessed using sheep erythrocytes. Crucial experimental parameters include:

    • Ensuring cell contact between bacteria and erythrocytes is maintained

    • Testing inhibition by different molecular weight carbohydrates

    • Including controls with YopB-deficient strains

  • Membrane disruption assays: Purified YopB can be directly tested for membrane disruptive activity in vitro using liposome-based assays or artificial membrane systems .

  • Control considerations:

    • Expression of YopE can reduce hemolytic activity, so researchers should control for the presence of other Yop proteins

    • High molecular weight carbohydrates (but not low molecular weight ones) can inhibit YopB-dependent hemolysis, providing useful controls

When designing these experiments, researchers should follow systematic experimental design principles, including:

  • Clearly defining independent variables (e.g., YopB concentration, presence of inhibitors)

  • Identifying dependent variables (e.g., hemolysis percentage)

  • Controlling extraneous variables that might confound results

What statistical approaches are appropriate for analyzing variability in recombinant protein production experiments?

When analyzing recombinant protein production trajectories, researchers face challenges with limited time-point measurements and few or no replicates. Appropriate statistical approaches include:

  • B-spline basis representation: This approach models production trajectories to make meaningful inferences across different experimental conditions, even with limited data points .

  • Bootstrap-based inference procedures: These can be used to account for parameter variability and multiple comparisons .

  • Analysis of functionals related to production, such as:

    • "Time to harvest" metrics

    • "Maximal productivity" parameters

For balanced experimental designs with sample size n for each combination of treatment and time point, researchers can model the response Y_ijk as:

Y_ijk = μ_i(t_ij) + ε_ijk

Where:

  • μ_i(t_ij) represents the mean response curve for the i-th treatment at time t_ij

  • ε_ijk are independent random variables with mean 0 and variance σ²

This approach is particularly valuable when the measurement process is destructive (as is often the case in protein production monitoring), requiring separate experimental units for each time point.

How can researchers effectively study YopB interactions with partner proteins?

Studying YopB's interactions with partner proteins requires specialized approaches due to the complexity of these interactions:

  • Co-expression systems: When studying YopB-YopD-SycD complexes, researchers have successfully used vectors containing all three open reading frames (ORFs) with an N-terminal His-tag on SycD. Both auto-induction and IPTG induction protocols can be employed, with auto-induction generally yielding better results .

  • Complex purification approaches:

    • Initial purification using Ni-affinity chromatography targeting the His-tagged component

    • Further purification by size exclusion chromatography to isolate intact complexes

    • Assessment of complex formation and stoichiometry using SDS-PAGE

  • Analytical challenges:

    • The three proteins may not express in stoichiometric ratios (observed ratios of approximately 4:1:2 for SycD:YopB:YopD)

    • YopB expression levels are typically lower than partner proteins, requiring optimization of expression conditions

What functional assays can verify the biological activity of recombinant YopB?

Confirming the biological activity of recombinant YopB is crucial to ensure that the protein retains its native functionality:

  • Cell infection assays: YopB's role in virulence can be assessed by testing the ability of bacteria expressing the recombinant protein to:

    • Elicit cytotoxic responses in cultured epithelial cells (e.g., HeLa cells)

    • Inhibit phagocytosis by macrophage-like cells (e.g., J774 cells)

  • Translocation assays: YopB's essential function in translocating Yop effector proteins can be verified by:

    • Detecting YopE or YopH within target cells following infection

    • Comparing wild-type strains with yopB mutant strains complemented with recombinant YopB

  • Hemolytic activity: YopB-dependent lysis of sheep erythrocytes can serve as a functional readout that correlates with pore formation ability .

What are the current challenges in structural studies of YopB and potential solutions?

Structural characterization of YopB presents several challenges:

How can researchers optimize experimental designs when studying YopB's role in virulence?

When investigating YopB's contribution to bacterial virulence, researchers should implement robust experimental design principles:

  • Systematic variable manipulation:

    • Independent variables: YopB expression levels, mutations in specific domains, presence of partner proteins

    • Dependent variables: Host cell cytotoxicity, effector protein translocation efficiency, animal model virulence metrics

    • Control for extraneous variables that might confound results

  • In vivo virulence assessment:

    • Comparison of wild-type and yopB mutant strains in appropriate animal models

    • Complementation studies with recombinant YopB to confirm functional restoration

    • Measurement of multiple virulence parameters (e.g., bacterial load, inflammatory markers, survival)

  • Randomization techniques:

    • Implement proper randomization in experimental setups to minimize systemic biases

    • Ensure balanced designs where possible to enhance statistical power

    • Consider the importance of replication to validate findings

What are the optimal storage conditions for maintaining recombinant YopB stability?

Maintaining the stability of recombinant YopB requires attention to storage conditions:

  • Short-term storage (2-4 weeks):

    • Store at 4°C in appropriate buffer

    • Suitable for intact vials that will be completely used within this timeframe

  • Long-term storage:

    • Store frozen at -20°C

    • Avoid multiple freeze-thaw cycles which can degrade protein quality

  • Buffer formulations:

    • Commercially available recombinant YopB is typically supplied in 20mM HEPES buffer (pH 7.6) with 250mM NaCl and 20% glycerol

    • The inclusion of glycerol (5-50%) in Tris/PBS-based buffers helps maintain stability

  • Lyophilized vs. liquid forms:

    • Lyophilized powder forms may offer greater stability for long-term storage

    • Liquid formulations provide convenience but may have shorter shelf lives

By optimizing storage conditions and minimizing freeze-thaw cycles, researchers can maintain the structural integrity and biological activity of recombinant YopB for extended periods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.