Recombinant Proteus mirabilis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is defined during production. Please specify your required tag type for prioritized development.
Synonyms
atpF; PMI3060; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Proteus mirabilis (strain HI4320)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAKAD AGEQLAKAKAEAQAIIESANKQRTQMIEEAKAEAEQERSKIVAQAQSELEAERKRAREEL RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases comprise two structural domains: F1, encompassing the extramembranous catalytic core, and F0, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.

Database Links

KEGG: pmr:PMI3060

STRING: 529507.PMI3060

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in Proteus mirabilis metabolism?

ATP synthase subunit b functions as part of the F₀ complex of ATP synthase, anchoring the enzyme to the membrane and participating in the proton transport mechanism essential for ATP production. In P. mirabilis, ATP synthase is critical for energy metabolism, particularly during infection when the bacterium must adapt to varying energy requirements during its pathogenic lifecycle. The enzyme is part of the core metabolic machinery that supports both adherent and motile phases of P. mirabilis, which transitions between these states during urinary tract infections . The energy provided through ATP synthase activity likely supports various virulence factors including fimbrial expression and motility systems that require significant energy expenditure during pathogenesis .

How is atpF gene expression regulated in P. mirabilis under different environmental conditions?

The expression of atpF in P. mirabilis responds to environmental cues similar to other metabolic genes. Though specific atpF regulation hasn't been directly characterized in the provided studies, transcriptomic analyses reveal that P. mirabilis significantly modulates its gene expression during infection. Major transcriptional regulators like MrpJ, which affects over 200 genes including those involved in metabolism and virulence, likely influence energy production pathways . During urinary tract infections, P. mirabilis must adapt to the urinary environment, which includes changes in pH due to urease activity and nutrient availability, all of which would affect ATP synthase expression and function. Research shows that genes related to core metabolic functions often show differential expression in vivo compared to laboratory conditions, suggesting that atpF regulation is integrated with the pathogen's adaptive responses .

What are the structural characteristics of P. mirabilis ATP synthase subunit b compared to other bacterial species?

While specific structural studies on P. mirabilis atpF are not detailed in the provided research, we can infer that it shares the canonical structure of bacterial ATP synthase subunit b: a transmembrane N-terminal domain and a cytoplasmic C-terminal domain that forms a dimeric right-handed coiled-coil structure. The protein likely contains conserved residues for interaction with other ATP synthase subunits, particularly subunit a and the α/β subunits of the F₁ complex. Comparative genomic analyses of P. mirabilis strains (such as HI4320, BB2000, and clinical isolates) would allow researchers to identify sequence conservation in atpF across the species . For experimental characterization, researchers would typically employ techniques such as X-ray crystallography or cryo-electron microscopy after expressing and purifying the recombinant protein.

How does atpF contribute to P. mirabilis fitness during single-species versus polymicrobial infections?

Genome-wide transposon mutagenesis studies provide insight into gene fitness contributions during infections. While atpF was not specifically highlighted in the transposon studies detailed in the search results, the research paradigm reveals how metabolic genes contribute differently to fitness depending on infection context . For example, research shows that branched-chain amino acid (BCAA) synthesis becomes essential for P. mirabilis during polymicrobial infections with Providencia stuartii, but not during single-species infections .

Similar context-dependent requirements might exist for energy metabolism genes like atpF. To investigate this, researchers could:

  • Generate atpF mutants using targeted mutagenesis approaches

  • Conduct competitive index experiments comparing wild-type and atpF mutant strains in:

    • In vitro culture conditions

    • Single-species catheter-associated UTI models

    • Polymicrobial infection models

An experimental design similar to the validation studies shown for other genes (like ilvD and livK) would be appropriate, where fitness is measured by relative bacterial counts in different organs and biofilms . The hypothesis would be that atpF might show differential fitness contributions depending on the metabolic demands imposed by competitive or cooperative interactions with other species.

What is the relationship between ATP synthase activity and MrpJ-regulated virulence networks in P. mirabilis?

MrpJ is a transcriptional regulator encoded by the last gene of the MR/P fimbrial operon that affects both motility and adherence in P. mirabilis . Microarray analysis has shown that MrpJ influences the expression of 217 genes related to virulence, secretion, and metabolism . Since ATP production is fundamental to energetically expensive processes like motility (via flagella) and protein synthesis (including fimbriae), there is likely a coordinated relationship between MrpJ regulation and ATP synthase activity.

To investigate this relationship, researchers could:

  • Perform transcriptional analysis of atpF expression in wild-type versus mrpJ mutant strains

  • Use chromatin immunoprecipitation (ChIP) techniques to determine if MrpJ directly binds to the atpF promoter region

  • Measure ATP synthase activity and ATP production levels in various genetic backgrounds (wild-type, mrpJ overexpression, and mrpJ deletion mutants)

  • Examine how MrpJ-mediated transitions between motile and adherent states affect energy metabolism gene expression

The experimental approach would mirror the ChIP studies conducted for other MrpJ targets, such as the flhDC promoter, which demonstrated direct binding of MrpJ to flagellar regulator promoters .

How does recombinant expression of P. mirabilis atpF affect the protein's structure-function relationship compared to native expression?

When expressing recombinant P. mirabilis atpF, researchers must consider how expression conditions might affect protein folding, post-translational modifications, and functionality compared to the native context. For optimal experimental design:

  • Expression system selection:

    • E. coli systems typically provide high yields but may lack P. mirabilis-specific chaperones

    • Homologous expression in P. mirabilis would maintain native folding environments but presents technical challenges

  • Purification strategy considerations:

    • Detergent selection for membrane protein extraction (critical for maintaining structure)

    • Affinity tag placement to minimize interference with function

    • Removal of tags post-purification if structural studies are planned

  • Functional assessment techniques:

    • ATP synthesis assays in reconstituted liposomes

    • Binding studies with other ATP synthase subunits

    • Proton translocation measurements

The functionality of recombinant atpF could be assessed by complementation studies in ATP synthase mutants, similar to validation approaches used for other P. mirabilis genes in the transposon mutagenesis studies .

What are the optimal conditions for expressing recombinant P. mirabilis atpF in heterologous systems?

Based on general principles for membrane protein expression and insights from P. mirabilis research, the following methodological approach is recommended:

Expression System Options:

Expression SystemAdvantagesDisadvantagesOptimization Parameters
E. coli BL21(DE3)High expression levels, well-establishedPotential folding issues with membrane proteinsTemperature (16-18°C optimal), inducer concentration (0.1-0.5 mM IPTG)
E. coli C41/C43Designed for membrane protein expressionLower yields than standard strainsExtended growth period, low inducer concentration
P. mirabilis (homologous)Native folding environmentTechnical difficulties, lower yieldsOptimization of promoter systems, induction timing
Cell-free systemsAvoids toxicity issuesExpensive, limited scaleDetergent selection, lipid supplementation

For successful expression, researchers should:

  • Clone atpF with a C-terminal His-tag to minimize interference with the N-terminal membrane domain

  • Use low-temperature induction (16-20°C) to slow protein production and improve folding

  • Include membrane-stabilizing agents like glycerol (5-10%) in the growth medium

  • Consider codon optimization if using E. coli, though P. mirabilis and E. coli share similar codon usage patterns

The purification protocol should employ gentle detergents (such as DDM or LMNG) that maintain the native structure of membrane proteins .

How can researchers design effective knockout and complementation studies for P. mirabilis atpF?

Genetic manipulation of P. mirabilis requires specialized approaches due to its swarming behavior and intrinsic resistance to some antibiotics. Based on successful mutagenesis strategies documented in the search results:

Knockout Strategies:

  • Allelic exchange using suicide vectors (similar to approaches used for other P. mirabilis genes)

    • Target vector delivery through conjugation with E. coli donor strains

    • Selection on media containing appropriate antibiotics

    • Counter-selection with sucrose if using sacB-based systems

  • Transposon mutagenesis followed by screening

    • Utilize approaches similar to the genome-wide mutagenesis described in the research

    • Screen for colonies with altered ATP production or growth characteristics

Complementation Approaches:

  • Chromosomal integration of atpF under native or inducible promoters

  • Plasmid-based complementation using vectors demonstrated to be stable in P. mirabilis

  • Expression of atpF with epitope tags to enable localization studies

Phenotypic Validation:

PhenotypeMeasurement MethodExpected Outcome in ΔatpFComplementation Assessment
Growth rateOD600 measurementsReduced growth, particularly in minimal mediaRestoration to wild-type growth rates
ATP levelsLuciferase-based assaysSignificantly decreased cellular ATPReturn to normal ATP levels
Membrane potentialFluorescent dyes (DiBAC4)Altered membrane potentialNormalization of membrane potential
Swarming motilitySwarming assays on agarReduced swarming due to energy deficiencyRestoration of swarming behavior
VirulenceMouse UTI modelsAttenuated virulenceRecovery of infection capability

These methodological approaches build on the successful genetic manipulation strategies demonstrated in the P. mirabilis transposon mutagenesis studies .

What techniques are most effective for studying interactions between atpF and other components of the ATP synthase complex?

Understanding protein-protein interactions within the ATP synthase complex requires specialized techniques suited to membrane protein complexes:

In vitro Interaction Studies:

  • Co-purification approaches

    • Tandem affinity purification using differentially tagged subunits

    • Size exclusion chromatography to isolate intact complexes

    • Blue native PAGE to preserve native protein-protein interactions

  • Biophysical characterization methods

    • Surface plasmon resonance (SPR) for measuring binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction interfaces

In vivo Interaction Studies:

  • Genetic approaches

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Suppressor mutation analysis to identify functional interactions

    • Synthetic lethality screens to identify genetic interactions

  • Microscopy techniques

    • Fluorescence resonance energy transfer (FRET) with fluorescently labeled subunits

    • Super-resolution microscopy for visualizing complex assembly

    • Immunolocalization using subunit-specific antibodies

Structural Studies:

  • Cryo-electron microscopy of purified ATP synthase complexes

  • Cross-linking mass spectrometry to identify proximity relationships

  • Computational modeling based on homologous structures

These approaches would parallel the chromatin immunoprecipitation and reporter assays used to study MrpJ-DNA interactions , but adapted for protein-protein interactions in a membrane environment.

How might targeting ATP synthase affect P. mirabilis virulence during catheter-associated UTIs?

ATP synthase represents a potential therapeutic target given its essential role in bacterial energy metabolism. Based on insights from P. mirabilis pathogenesis studies:

  • ATP synthase inhibition would likely affect multiple virulence processes:

    • Swarming motility, which is energy-intensive and crucial for catheter colonization

    • Fimbrial production, important for adhesion to catheter surfaces and host tissues

    • Urease activity, which requires ATP for assembly and function

    • Biofilm formation, an energy-dependent process critical in CAUTIs

  • Therapeutic targeting considerations:

    • Specificity for bacterial versus human ATP synthase

    • Delivery challenges in the urinary tract environment

    • Potential for resistance development

  • Experimental approaches to investigate this question:

    • Sub-inhibitory concentrations of ATP synthase inhibitors in virulence assays

    • Catheter biofilm formation studies with atpF mutants or under inhibitor treatment

    • In vivo studies using the mouse catheter model with targeted atpF mutation

Given that metabolism-targeting approaches must consider interactions in polymicrobial settings, researchers should evaluate ATP synthase inhibition in both single-species and polymicrobial contexts, similar to the studies of branched-chain amino acid metabolism in mixed infections .

What role might atpF play in P. mirabilis adaptation to the catheterized urinary tract environment?

The catheterized urinary tract presents unique challenges for bacterial metabolism, including fluctuating pH, limited oxygen availability, and changing nutrient profiles. ATP synthase likely plays a crucial role in adaptation to this environment:

  • pH adaptation considerations:

    • P. mirabilis urease activity raises urinary pH

    • ATP synthase function is affected by pH gradients

    • Coordinated regulation of urease and ATP synthase may be necessary

  • Biofilm-specific energy requirements:

    • Different metabolic states exist in biofilm layers

    • ATP synthesis needs differ between planktonic and biofilm cells

    • Energy distribution within structured communities

  • Experimental approaches:

    • Transcriptional profiling of atpF during biofilm formation vs. planktonic growth

    • ATP measurements in different biofilm regions

    • pH-dependent ATP synthase activity assays

    • Comparative fitness of atpF mutants in catheter biofilms vs. planktonic culture

This research direction would complement existing knowledge of how P. mirabilis adapts its virulence factor expression during catheter colonization by focusing on the energetic aspects of this adaptation.

How can systems biology approaches integrate atpF function into comprehensive models of P. mirabilis pathogenesis?

Systems biology offers powerful frameworks for understanding how individual components like atpF contribute to the broader pathogenic capabilities of P. mirabilis:

  • Multi-omics integration strategies:

    • Combine transcriptomics (like the MrpJ regulon studies ) with proteomics and metabolomics

    • Map energy flux during different phases of infection

    • Correlate ATP synthase expression/activity with virulence factor production

  • Network modeling approaches:

    • Construct metabolic models incorporating ATP production/consumption

    • Develop regulatory networks connecting energy metabolism with virulence circuits

    • Create predictive models of how energy availability affects virulence expression

  • Experimental validation methods:

    • Targeted metabolic flux analysis using isotope labeling

    • Time-course sampling during infection progression

    • Perturbation studies with genetic and pharmacological tools

This systems-level understanding would build upon the transcriptomic networks identified for MrpJ and the fitness factor networks revealed by transposon mutagenesis , creating a more comprehensive model of how P. mirabilis coordinates metabolism and virulence.

What technological advances are needed to better study ATP synthase dynamics in P. mirabilis during infection?

Current technological limitations constrain our understanding of real-time energy metabolism during infection. Future research would benefit from:

  • Advanced imaging technologies:

    • Real-time ATP sensing in live infection models

    • Single-cell resolution of ATP synthase activity in biofilms

    • Intravital microscopy compatible with urinary tract infection models

  • Improved genetic tools:

    • Inducible/repressible atpF expression systems for temporal control

    • Site-specific mutagenesis of key residues without polar effects

    • Reporter systems for ATP levels that function in infection settings

  • Enhanced infection models:

    • Microfluidic catheter models that mimic flow conditions

    • Tissue-engineered bladder models with relevant cell types

    • Improved animal models that better recapitulate human catheter biofilms

These technological developments would address current limitations in studying dynamic processes during infection and allow for more precise understanding of how ATP synthase function contributes to the complex process of catheter-associated UTIs caused by P. mirabilis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.