Recombinant Proteus mirabilis Cardiolipin synthase (cls)

What is Cardiolipin synthase and what is its function in Proteus mirabilis?

Cardiolipin synthase (cls) in Proteus mirabilis is an enzyme responsible for the biosynthesis of cardiolipin (CL), a phospholipid that constitutes approximately 5-15% of the bacterial membrane phospholipids depending on growth conditions and phase . In P. mirabilis, cardiolipin synthase A (clsA) is encoded by the clsA gene (also known as cls or PMI1357) . The enzyme catalyzes the formation of cardiolipin, which plays crucial roles in membrane organization, protein function, and bacterial adaptation to environmental stresses. Similar to its E. coli counterpart, the P. mirabilis cardiolipin synthase likely belongs to the phospholipase D superfamily .

What is the structural composition of recombinant P. mirabilis Cardiolipin synthase?

Recombinant P. mirabilis Cardiolipin synthase (cls) is a full-length protein consisting of 486 amino acids . The amino acid sequence begins with MTTFYTVLSWLTFFFYWLLIAGVTFRVLMHRRPVTSTMTWLLIIYILPLVGVIAYFAFGE and continues through the entire 486-residue sequence . The protein likely contains transmembrane domains as suggested by its hydrophobic amino acid composition and similarity to other bacterial cardiolipin synthases . Based on homology with E. coli cardiolipin synthases, the P. mirabilis enzyme likely contains conserved catalytic motifs characteristic of the phospholipase D superfamily that are essential for its enzymatic activity .

What is the relationship between Cardiolipin synthase activity and P. mirabilis swarming behavior?

P. mirabilis exhibits a distinctive swarming motility behavior that involves dramatic cell elongation and coordinated movement across surfaces. Research indicates that this swarming process is accompanied by significant changes in phospholipid composition. During the transition to swarmer cells, P. mirabilis demonstrates increased levels of 32- and 34-carbon phospholipids (ranging from 36% to 600% for PE 34:1 and PE 34:2, respectively) and dramatic reduction in 31- and 33-carbon lipids . These modifications suggest that Cardiolipin synthase activity may be differentially regulated during the swarming process to accommodate the dramatic morphological changes. The lipid composition changes during swarming appear to affect membrane fluidity, as evidenced by the melting of ordered lipid rafts present in short-form rods and the corresponding homogeneity of lipid bilayers in long-form swarmer cells . This relationship between phospholipid composition, membrane organization, and cellular morphology suggests that Cardiolipin synthase plays a role in facilitating the dramatic physiological changes associated with P. mirabilis swarming behavior.

What role does Cardiolipin synthase play in P. mirabilis biofilm formation and stress responses?

While the search results don't directly address P. mirabilis biofilm formation, insights can be drawn from studies on E. coli. In E. coli, the absence of cardiolipin activates the Regulation of Colanic Acid Synthesis (Rcs) envelope stress response, which represses flagella production, disrupts initial biofilm attachment, and reduces biofilm growth . Cardiolipin deficiency in E. coli also impairs protein translocation across the inner membrane, potentially activating the Rcs pathway through the outer membrane lipoprotein RcsF . By analogy, P. mirabilis Cardiolipin synthase likely plays a critical role in maintaining membrane integrity, facilitating protein translocation, and supporting biofilm formation. The relationship between Cardiolipin synthase activity and stress responses suggests that this enzyme could be a potential target for modulating P. mirabilis virulence, as P. mirabilis is a common cause of urinary tract infections where biofilm formation contributes significantly to pathogenesis and antibiotic resistance.

What expression systems are optimal for producing recombinant P. mirabilis Cardiolipin synthase?

Based on the available information, E. coli expression systems have been successfully used to produce recombinant P. mirabilis Cardiolipin synthase . When designing expression systems, researchers should consider:

• Expression vector selection: Vectors with inducible promoters (such as the arabinose-inducible pBAD30 system used for E. coli cardiolipin synthases) allow controlled expression .

• Host strain optimization: E. coli strains lacking endogenous cardiolipin synthases (ΔclsABC) can be used to eliminate background activity when characterizing the recombinant enzyme .

• Membrane protein considerations: As Cardiolipin synthase is a membrane protein, expression conditions should be optimized to prevent aggregation and ensure proper membrane integration. Lower induction temperatures (16-25°C) and reduced inducer concentrations often improve membrane protein expression.

• Co-expression strategies: If P. mirabilis Cardiolipin synthase requires cofactors or accessory proteins (similar to how E. coli ClsC requires YmdB for optimal activity), co-expression may significantly improve enzymatic activity .

What analytical methods are most effective for characterizing Cardiolipin synthase activity?

Several complementary analytical approaches can be employed to characterize P. mirabilis Cardiolipin synthase activity:

Researchers have successfully used mass spectrometry methods to detect cardiolipin production by recombinant cardiolipin synthases, even when the levels were too low to be detected by TLC . For detailed characterization of substrate specificity, in vitro assays using synthetic phospholipids with defined acyl chains can be analyzed by MRM to track the incorporation of phosphatidyl groups into cardiolipin .

How can researchers effectively investigate the substrate specificity of P. mirabilis Cardiolipin synthase?

To investigate substrate specificity of P. mirabilis Cardiolipin synthase, researchers can adapt approaches used for E. coli enzymes:

• In vitro reconstitution assays: Purified recombinant enzyme can be incubated with synthetic phospholipid substrates (e.g., PG and PE with defined acyl chains) to determine which lipids serve as phosphatidyl donors . Specific substrate combinations (e.g., PG+PG or PG+PE) can reveal the preferred reaction mechanism.

• MS/MS analysis of products: Using synthetic phospholipids with unique fatty acid compositions allows tracking of phosphatidyl group transfer using multiple reaction monitoring (MRM) . For example, when E. coli ClsC was incubated with PG (12:0/13:0) and PE (14:1/17:0), the resulting cardiolipin contained the distinctive acyl chains from both substrates, confirming PE as the phosphatidyl donor .

• Site-directed mutagenesis: Mutation of putative catalytic motifs (as demonstrated for E. coli ClsC) can confirm the catalytic mechanism . The phospholipase D superfamily typically contains conserved HKD motifs essential for activity.

• Complementation studies: Expression of recombinant P. mirabilis Cardiolipin synthase in E. coli ΔclsABC mutants can reveal its ability to restore cardiolipin synthesis under various growth conditions, providing insights into its physiological function .

What are the implications of targeting P. mirabilis Cardiolipin synthase for developing novel antimicrobials?

The relationship between cardiolipin and bacterial stress responses, biofilm formation, and protein translocation suggests that P. mirabilis Cardiolipin synthase could be a promising target for antimicrobial development. In E. coli, cardiolipin deficiency activates stress responses and impairs biofilm formation , suggesting that similar effects might occur in P. mirabilis. Since P. mirabilis is a common cause of urinary tract infections and catheter-associated infections, inhibiting Cardiolipin synthase could potentially reduce its virulence and biofilm formation capabilities. Future research should investigate:

• The effects of cardiolipin depletion on P. mirabilis swarming motility, which is a key virulence factor.

• Whether cardiolipin synthase inhibitors could sensitize P. mirabilis to existing antibiotics.

• The potential for synergistic antimicrobial effects when combining cardiolipin synthase inhibitors with compounds targeting other aspects of bacterial membrane function.

How does P. mirabilis regulate Cardiolipin synthase expression during different growth phases and environmental conditions?

Understanding the regulatory mechanisms controlling P. mirabilis Cardiolipin synthase expression could provide insights into bacterial adaptation strategies. In E. coli, different cardiolipin synthases are active under specific conditions: ClsA contributes detectible levels of cardiolipin at low osmolarity during logarithmic growth, while all three synthases increase activity with increasing osmolarity and during stationary phase . For P. mirabilis, researchers should investigate:

• Transcriptional regulation of the clsA gene during different growth phases, particularly during the transition to swarmer cells.

• Post-translational modifications that might affect enzyme activity in response to environmental stresses.

• The relationship between cardiolipin synthesis and the dramatic phospholipid composition changes observed during swarming .

• Potential cofactors or interacting proteins that might modulate P. mirabilis Cardiolipin synthase activity, similar to the YmdB-ClsC interaction in E. coli .