Recombinant Proteus mirabilis Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Overview of Proteus mirabilis

Proteus mirabilis is a Gram-negative, rod-shaped bacterium known for its swarming motility and urease activity . It is a frequent cause of catheter-associated urinary tract infections (CAUTIs) . These infections are often polymicrobial and can lead to urolithiasis, the formation of bladder or kidney stones, due to the alkalinization of urine from urease-catalyzed urea hydrolysis . P. mirabilis utilizes various virulence factors to colonize the urinary tract, including urease and the ability to form stones .

Fumarate Reductase in Proteus mirabilis

Fumarate reductase is an enzyme that catalyzes the interconversion of fumarate and succinate . In P. mirabilis, fumarate reductase allows the bacterium to operate a reductive, branched tricarboxylic acid (TCA) cycle, especially in the absence of succinate dehydrogenase . While fumarate reductase (FrdA) is not required for swarming under all tested conditions, it may play a role in specific scenarios, such as in sdhB mutants under conditions of excess malate or glutamine . The frdD gene encodes one of the subunits of the fumarate reductase enzyme complex in P. mirabilis .

Role of Fumarate Reductase Subunit D (FrdD)

FrdD is a subunit of the fumarate reductase enzyme . Fumarate reductase is a membrane-bound enzyme that is part of the succinate dehydrogenase/fumarate reductase complex, which functions in both the citric acid cycle and anaerobic respiration . The frdD gene in P. mirabilis is designated as PMI3585 in the KEGG database and 529507.PMI3585 in STRING .

Swarming Motility and the TCA Cycle

P. mirabilis exhibits swarming motility, a coordinated surface migration that is important for its pathogenesis . The TCA cycle plays a role in this swarming behavior . Mutants with aberrant TCA cycle function, such as fumC, show decreased swarming in response to arginine and ornithine . The addition of malate can complement the swarming defect of the fumC mutant, indicating that excess malate promotes a complete oxidative TCA cycle .

Antibiotic Resistance in Proteus mirabilis

Antibiotic resistance in P. mirabilis is a significant concern, complicating the treatment of infections . Resistance mechanisms include transferable plasmids, insertion sequences, transposons, and integrons . Integrons, which are often located on mobile plasmids, facilitate the horizontal gene transfer of resistance genes, including those encoding resistance to β-lactams, aminoglycosides, and quinolones . Multidrug-resistant (MDR) P. mirabilis strains are increasingly prevalent, leading to public health concerns . The ability of P. mirabilis to form crystalline MDR biofilms is a major factor in recurrent CAUTIs .

Virulence Factors and Biofilm Formation

P. mirabilis produces several virulence factors that contribute to its pathogenicity, including swarming motility, fimbriae, urease production, capsule polysaccharide, and efflux pumps . Biofilm formation is a multistage process involving reversible adhesion, irreversible attachment, microcolony formation, and mature biofilm development . Biofilm-embedded cells are more resistant to antimicrobial treatment and host immune responses compared to planktonic cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; PMI3585; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Proteus mirabilis (strain HI4320)
Target Names
frdD
Target Protein Sequence
MNQNQLPKRSDEPIFWGLFGAGGMWSAIVSPAIIILLGILIPMGIAPEAFTYDRIMAFSQ GFIGRIFLLLMIILPVWCALHRIHHTLHDFKVHVPASNWVFYGAAAIISVIAIIGVFTL
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (anaerobic growth) and succinate dehydrogenase (aerobic growth). Fumarate reductase subunit D anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links

KEGG: pmr:PMI3585

STRING: 529507.PMI3585

Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of fumarate reductase in P. mirabilis metabolism?

Proteus mirabilis forms fumarate reductase under anaerobic growth conditions, where it plays a critical role in anaerobic respiration. This enzyme catalyzes the reduction of fumarate to succinate, allowing P. mirabilis to use fumarate as a terminal electron acceptor when oxygen is unavailable. The formation of this reductase is repressed under conditions where electron transport to oxygen or nitrate is possible, demonstrating its specialized role in anaerobic adaptation . The fumarate reductase system enables P. mirabilis to survive in oxygen-limited environments such as the urinary tract, particularly during catheter-associated infections where biofilm formation creates oxygen gradients.

How is the frdD subunit organized within the fumarate reductase complex?

The frdD subunit functions as one of the membrane-anchoring proteins in the fumarate reductase complex. The complete fumarate reductase typically consists of four subunits: FrdA (flavoprotein), FrdB (iron-sulfur protein), and FrdC and FrdD (membrane anchor proteins). Spectral investigation of P. mirabilis cytoplasmic membranes revealed the presence of multiple cytochromes, including at least two types of cytochrome b, cytochrome a1, and cytochrome d . FrdD, along with FrdC, anchors the catalytic subunits (FrdA and FrdB) to the cytoplasmic membrane, facilitating electron transfer through the membrane during anaerobic respiration.

What is known about the genetic organization of the frd operon in P. mirabilis?

While the search results don't specifically detail the genetic organization of the frd operon in P. mirabilis, research indicates that P. mirabilis has complex genetic regulation systems, particularly for factors involved in anaerobic metabolism. Similar to other Enterobacteriaceae, the frd genes in P. mirabilis are likely organized in an operon structure that is regulated by oxygen availability and potentially by other environmental signals. P. mirabilis is known to acquire genes through transferable plasmids, insertion sequences, transposons, and integrons , suggesting that the regulation and genetic context of the frd operon may be subject to horizontal gene transfer and regulatory adaptation.

What expression systems are most effective for recombinant P. mirabilis frdD production?

For membrane proteins like frdD, E. coli-based expression systems with tight regulation are typically most effective. When expressing recombinant P. mirabilis frdD, researchers should consider the following system characteristics:

Expression SystemAdvantagesChallengesRecommended Applications
E. coli BL21(DE3)High yield, well-established protocolsPossible inclusion body formationInitial expression screening
E. coli C41/C43Specialized for membrane proteinsLower yields than BL21Difficult-to-express membrane proteins
E. coli Lemo21Tunable expression levelRequires optimizationFine-tuning expression levels
Cell-free systemsAvoids toxicity issuesHigher cost, lower yieldHighly toxic membrane proteins

The expression should be conducted under controlled anaerobic conditions to mimic the natural environment where fumarate reductase is expressed in P. mirabilis .

What are the optimal conditions for solubilizing and purifying recombinant frdD?

As a membrane protein, frdD requires specific solubilization and purification strategies:

  • Membrane preparation: Cytoplasmic membrane suspensions can be isolated from anaerobically grown cultures by differential centrifugation .

  • Solubilization: Mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration are recommended.

  • Purification: A two-step purification using nickel affinity chromatography followed by size exclusion chromatography typically yields the purest protein.

  • Buffer optimization: Buffers containing 20-50 mM phosphate or Tris at pH 7.2-7.6 with 100-150 mM NaCl provide stability.

Throughout purification, it's essential to maintain the protein in a detergent micelle environment to prevent aggregation and maintain native-like structure.

How can researchers verify the correct folding and functionality of purified recombinant frdD?

Several complementary techniques can assess the integrity of purified frdD:

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

  • Thermal shift assays to assess protein stability

  • Reconstitution into liposomes followed by functional assays

  • Assessment of interaction with other fumarate reductase subunits

For functional verification, researchers can measure electron transport activities in reconstituted systems using formate or NADH as electron donors and fumarate as the acceptor. Inhibitors like 2-n-heptyl-4-hydroxyquinoline-N-oxide and antimycin A can be used to verify the specific electron transport pathway .

What structural features define P. mirabilis frdD and how do they compare to homologs from other species?

While specific structural data for P. mirabilis frdD is not explicitly detailed in the search results, comparative analysis with homologous proteins would likely reveal:

  • Hydrophobic transmembrane helices that anchor the protein in the cytoplasmic membrane

  • Conserved residues involved in interaction with FrdC and the catalytic subunits

  • Structural elements that facilitate menaquinone binding, which plays a crucial role in the fumarate/formate pathway

Spectroscopic techniques have shown that P. mirabilis cytoplasmic membranes contain multiple cytochromes, including cytochrome b, which is directly involved in electron transport to fumarate. Cytochrome b was found to be reduced by both NADH and formate to approximately 80% , suggesting a key role in the electron transport chain that includes frdD.

How does frdD contribute to electron transport in the fumarate reductase complex?

The frdD subunit, along with FrdC, provides a membrane anchor for the catalytic components and participates in the electron transport chain. In P. mirabilis, experimental evidence suggests that:

  • The preferential route for electron transport from formate and NADH to fumarate includes cytochrome b as a directly involved carrier .

  • Menaquinone plays a more exclusive role in the formate/fumarate pathway than in electron transport to oxygen, as demonstrated by UV-irradiation experiments on cytoplasmic membrane suspensions .

  • The inhibition of respiratory activity by HQNO and antimycin A occurs at the oxidation side of cytochrome b , indicating the position of this component in the electron transport chain.

These findings suggest that frdD likely interacts with menaquinone and contributes to the formation of a functional quinone-binding site within the fumarate reductase complex.

What spectroscopic techniques are most informative for studying frdD interactions within the fumarate reductase complex?

Based on the research methodologies described in the literature, several spectroscopic approaches are valuable:

  • Absorption spectroscopy to monitor cytochrome reduction states during electron transport

  • EPR (Electron Paramagnetic Resonance) spectroscopy to characterize iron-sulfur clusters and their interaction with the membrane components

  • FTIR (Fourier-Transform Infrared) spectroscopy to examine protein-lipid interactions

  • Fluorescence spectroscopy with labeled quinone analogs to study binding kinetics

How is frdD expression regulated in response to environmental oxygen levels?

The expression of fumarate reductase in P. mirabilis is tightly regulated by oxygen availability. Research has demonstrated that:

  • P. mirabilis forms fumarate reductase specifically under anaerobic growth conditions .

  • The formation of this reductase is repressed when electron transport to oxygen or nitrate is possible .

  • This oxygen-responsive regulation ensures that the energetically less favorable fumarate respiration is only activated when necessary.

The specific molecular mechanisms of this regulation in P. mirabilis are not fully detailed in the search results, but likely involve oxygen-sensing transcription factors similar to those in related Enterobacteriaceae, such as FNR (fumarate and nitrate reduction regulator) and ArcAB (aerobic respiration control) two-component system.

What is the relationship between fumarate reductase activity and P. mirabilis survival in oxygen-limited environments?

Fumarate reductase plays a crucial role in P. mirabilis adaptation to oxygen-limited environments, such as those encountered during urinary tract infections. The ability to use fumarate as a terminal electron acceptor allows P. mirabilis to:

  • Maintain energy production through anaerobic respiration when oxygen is limited

  • Colonize the deeper layers of biofilms where oxygen is scarce

  • Survive in catheter-associated urinary tract infections where biofilm formation creates anaerobic niches

P. mirabilis is known to cause between 1-10% of all urinary tract infections and is especially prevalent in catheter-associated UTIs (10-44% of long-term CAUTIs) . The ability to grow anaerobically using fumarate respiration likely contributes to this pathogen's persistence in these environments.

How do mutations in frdD affect anaerobic growth and bacterial fitness?

While the search results don't specifically address mutations in frdD, research on chlorate-resistant mutant strains of P. mirabilis provides some insights. In two of three tested chlorate-resistant mutant strains, fumarate reductase appeared to be affected , suggesting that:

  • Mutations affecting fumarate reductase components, potentially including frdD, can impact the ability to use fumarate as an electron acceptor

  • Such mutations may have pleiotropic effects on anaerobic metabolism

  • The bacterial fitness cost of these mutations likely depends on environmental conditions

The specific effects of frdD mutations would need to be assessed through careful phenotypic analysis, including growth rate measurements under various anaerobic conditions and competitive fitness assays against wild-type strains.

What genetic approaches are most effective for creating frdD knockouts or site-directed mutants in P. mirabilis?

Creating genetic modifications in P. mirabilis presents unique challenges compared to model organisms. Recommended approaches include:

  • Allelic exchange using suicide vectors containing counterselectable markers

  • CRISPR-Cas9 systems adapted for P. mirabilis

  • Transposon mutagenesis followed by screening for frdD disruptions

When designing these experiments, researchers should consider P. mirabilis' natural resistance mechanisms and potential barriers to genetic manipulation. P. mirabilis acquires genes encoding antimicrobial resistance via transferable plasmids, insertion sequences, transposons, and integrons , which provides insight into potential vectors for genetic engineering.

How can researchers distinguish between phenotypes caused by loss of frdD versus polar effects on other frd operon genes?

To distinguish direct frdD effects from polar effects:

  • Create in-frame, scarless deletions that don't affect downstream gene expression

  • Complement the mutation with wild-type frdD expressed from a plasmid or different chromosomal location

  • Perform qRT-PCR to verify expression levels of other frd operon genes in the mutant

  • Create site-directed mutations that alter function without affecting expression

Additionally, researchers should consider the possibility of compensatory changes in other electron transport components when interpreting phenotypes of frdD mutants.

What transcriptomic approaches can reveal the regulatory network controlling frdD expression?

Advanced transcriptomic methods to elucidate frdD regulation include:

  • RNA-Seq under varying oxygen levels and growth conditions

  • ChIP-Seq to identify transcription factors binding to the frd operon promoter

  • 5' RACE to precisely map transcription start sites

  • Ribosome profiling to assess translational regulation

These approaches can reveal how P. mirabilis coordinates frdD expression with other components of anaerobic metabolism and identify potential novel regulators specific to this organism's unique lifestyle and environmental adaptations.

Is there evidence linking fumarate reductase activity to P. mirabilis virulence in urinary tract infections?

While the search results don't directly connect fumarate reductase to virulence, there's indirect evidence suggesting potential contributions:

  • P. mirabilis is capable of causing symptomatic infections of the urinary tract including cystitis and pyelonephritis .

  • The ability to thrive anaerobically would provide an advantage in the oxygen-limited environment of urinary biofilms.

  • P. mirabilis infections can lead to stone formation (urolithiasis) , which may be influenced by metabolic activities including anaerobic respiration.

To directly test this connection, researchers would need to compare the virulence of wild-type P. mirabilis with fumarate reductase mutants in animal models of urinary tract infection. Such experiments could assess bacterial burden, tissue damage, and the formation of crystalline biofilms.

How might frdD contribute to P. mirabilis survival during antibiotic treatment?

Several mechanisms could connect frdD to antibiotic tolerance:

  • Anaerobic growth mediated by fumarate reductase may reduce the efficacy of antibiotics that target actively dividing cells.

  • Metabolic adaptation through alternative electron acceptors may help bacteria survive during antibiotic stress.

  • The membrane localization of frdD might influence membrane permeability to certain antibiotics.

P. mirabilis has been shown to develop resistance to multiple antibiotics, including extended-spectrum beta-lactams, cephalosporins, fluoroquinolones, and aminoglycosides . While not specifically linked to fumarate reductase, these resistance mechanisms demonstrate the adaptability of this pathogen and suggest that metabolic flexibility could contribute to survival under antibiotic pressure.

Does fumarate reductase activity influence biofilm formation or maintenance in P. mirabilis?

Biofilm formation is a key virulence factor in P. mirabilis, particularly in catheter-associated UTIs. While not explicitly addressed in the search results, fumarate reductase likely contributes to biofilm metabolism through:

  • Enabling growth in the oxygen-limited depths of mature biofilms

  • Contributing to the metabolic heterogeneity within biofilm populations

  • Potentially influencing the extracellular matrix composition through altered metabolite production

Further research using biofilm models and comparing wild-type to fumarate reductase mutants would be needed to fully elucidate this relationship. The swarming behavior of P. mirabilis, another key aspect of its pathogenesis , might also be influenced by metabolic adaptations involving fumarate reductase.

How can structural insights from frdD be applied to develop new antimicrobial strategies?

The membrane-associated fumarate reductase complex represents a potential target for novel antimicrobials based on several factors:

  • It is essential for anaerobic growth, which is relevant to infection sites

  • The membrane localization makes it potentially accessible to drugs

  • Structural differences from mammalian enzymes could allow selective targeting

Potential therapeutic approaches could include:

  • Small molecule inhibitors targeting the quinone binding site

  • Peptides disrupting the assembly of the fumarate reductase complex

  • Compounds that interfere with electron transfer between subunits

The increasing prevalence of antibiotic resistance in P. mirabilis (48% of strains exhibiting resistance) underscores the need for novel therapeutic targets like the fumarate reductase complex.

What are the most promising approaches for studying frdD protein-protein interactions within the membrane?

Advanced techniques for studying membrane protein interactions include:

  • Cross-linking mass spectrometry (XL-MS) to capture in situ interactions

  • Förster resonance energy transfer (FRET) with fluorescently labeled subunits

  • Cryo-electron microscopy of the intact complex

  • Native mass spectrometry of the purified complex

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify interaction surfaces

These techniques can reveal how frdD interacts with other fumarate reductase subunits and potentially with other membrane components involved in electron transport. The interaction with menaquinone, which plays a more exclusive role in the formate/fumarate pathway , would be of particular interest.

How can systems biology approaches integrate frdD function into models of P. mirabilis metabolism?

Systems biology approaches can place frdD within the broader context of P. mirabilis metabolism:

These approaches can help researchers understand how P. mirabilis coordinates central carbon metabolism, electron transport chains, and energy production during transitions between aerobic and anaerobic conditions. Such insights could reveal new vulnerabilities for therapeutic targeting and explain this pathogen's remarkable adaptability in diverse host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.