Recombinant Proteus mirabilis Large-conductance mechanosensitive channel (mscL)

What is the Proteus mirabilis Large-conductance mechanosensitive channel (mscL)?

The mscL protein from Proteus mirabilis is a mechanosensitive channel protein consisting of 135 amino acids. It belongs to the family of large-conductance mechanosensitive channels that respond to membrane tension. The full amino acid sequence is: MAFFKEFREFAMKGNVVDMAVGVIIGAAFGKIVSSLVADVIMPPLGLLIGGIDFKQFSLVLREAHGDIPAVILNYGAFIQTVFDFAIVAFAIFCAIKLINKMRRQEEEQPKAPPAPSAEETTLLTEIRDLLKNQQK . This channel plays a critical role in osmoregulation in bacterial cells, opening in response to increased membrane tension to prevent cell lysis during osmotic downshock.

How does the mscL protein from Proteus mirabilis compare to other bacterial mechanosensitive channels?

The Proteus mirabilis mscL protein shares structural similarities with other bacterial large-conductance mechanosensitive channels, particularly in the transmembrane domains and gating regions. While the core functional mechanism remains conserved, species-specific variations exist in the C-terminal region that may influence channel gating kinetics and sensitivity to membrane tension. Unlike small-conductance mechanosensitive channels (MscS), the MscL channels typically have larger conductance and require greater membrane tension to activate, serving as a last line of defense against osmotic stress .

What biological role does mscL play in Proteus mirabilis physiology?

In Proteus mirabilis, mscL likely functions as a critical osmotic safety valve that opens upon increased membrane tension to release cytoplasmic contents and prevent cell lysis during sudden osmotic downshock. While not extensively characterized specifically in P. mirabilis, mechanosensitive channels in related bacteria have been implicated in various physiological processes beyond osmotic regulation, including potential roles in virulence, biofilm formation, and adaptation to environmental stresses. Given P. mirabilis's notable multicellular behaviors and pathogenicity mechanisms, mscL may contribute to its ability to colonize and persist in challenging host environments, particularly during urinary tract infections .

What expression systems are optimal for recombinant production of P. mirabilis mscL?

For efficient expression of recombinant P. mirabilis mscL, E. coli-based expression systems have proven effective as indicated in the available research data . When designing expression constructs, researchers should consider:

• Vector selection: pET series vectors under T7 promoter control are commonly used for membrane protein expression

• E. coli strain optimization: BL21(DE3), C41(DE3), or C43(DE3) strains are preferred for membrane protein expression

• Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) often improve membrane protein folding

• Tag placement: N-terminal His-tags are commonly employed, as demonstrated in successful expression protocols
  An optimized protocol should include careful monitoring of expression levels via Western blotting during protocol development to confirm successful protein production.

What purification strategy yields the highest quality P. mirabilis mscL protein preparations?

Purification of the His-tagged P. mirabilis mscL protein typically follows a multi-step approach:

• Membrane fraction isolation: Cell lysis followed by differential centrifugation to isolate membrane fractions

• Detergent solubilization: Carefully selected detergents (DDM, LDAO, or OG) to extract the membrane protein

• Immobilized metal affinity chromatography (IMAC): Utilizing the His-tag for initial purification

• Size exclusion chromatography: For final polishing and buffer exchange
  The recommended storage buffer contains Tris-based buffer with 50% glycerol , which helps maintain protein stability. Final preparations should achieve >90% purity as determined by SDS-PAGE . For long-term storage, aliquoting the protein and storing at -20°C/-80°C is recommended to prevent repeated freeze-thaw cycles that could compromise protein integrity .

How can researchers assess the structural integrity and functional activity of purified mscL protein?

To verify the quality of purified P. mirabilis mscL preparations, researchers should implement a comprehensive quality control pipeline:

• Purity assessment: SDS-PAGE analysis with Coomassie staining (target >90% purity)

• Western blot: Confirmation of identity using anti-His antibodies

• Circular dichroism (CD) spectroscopy: Verification of secondary structure composition

• Size exclusion chromatography-multi-angle light scattering (SEC-MALS): Assessment of oligomeric state

• Functional verification: Reconstitution into liposomes followed by patch-clamp electrophysiology or fluorescence-based flux assays to confirm channel activity
  For functional assays, reconstitution protocols typically involve:

• Preparation of liposomes (commonly using E. coli polar lipids or synthetic lipid mixtures)

• Detergent-mediated protein incorporation

• Detergent removal via biobeads or dialysis

• Functional testing through osmotic shock response or direct electrophysiological measurements

What electrophysiological methods are most appropriate for characterizing P. mirabilis mscL channel properties?

For comprehensive electrophysiological characterization of P. mirabilis mscL, researchers should consider multiple complementary approaches:

• Patch-clamp in reconstituted systems:

  • Planar lipid bilayer recording: Allows precise control of membrane composition and tension

  • Giant unilamellar vesicle (GUV) patch-clamp: Provides native-like membrane environment

  • Parameters to measure: Single-channel conductance, gating tension threshold, opening/closing kinetics

• Pressure-sensitive patch fluorometry:

  • Combined fluorescence imaging with patch-clamp

  • Enables correlation of structural changes (using fluorescently labeled protein) with functional outcomes

• Experimental conditions to optimize:

  • Buffer composition (pH, ionic strength)

  • Membrane tension application method (negative pressure, osmotic gradients)

  • Temperature control for kinetic studies
    When comparing results with other mechanosensitive channels, researchers should standardize tension application methods to enable direct comparisons of gating thresholds and conductance properties.

How can structural studies enhance our understanding of P. mirabilis mscL function?

Structural characterization of P. mirabilis mscL requires multiple complementary approaches:

• X-ray crystallography: Challenging for membrane proteins but can provide high-resolution structures

  • Requires optimization of detergent conditions and crystal formation parameters

  • Consider lipidic cubic phase crystallization methods

• Cryo-electron microscopy:

  • Increasingly powerful for membrane protein structure determination

  • Sample preparation optimization critical (detergent selection, grid preparation)

• Molecular dynamics simulations:

  • Can model conformational changes during channel gating

  • Requires integration with experimental data for validation

  • Parameter adjustments needed for accurate membrane environment modeling

• Hydrogen-deuterium exchange mass spectrometry:

  • Provides insights into dynamic regions and conformational changes

  • Can identify regions involved in tension sensing
    Integration of structural data with functional studies is essential for mapping structure-function relationships in the channel protein and identifying key residues involved in mechanosensation.

What in vitro assays can demonstrate the mechanosensitive properties of purified mscL?

Several complementary in vitro assays can verify the mechanosensitive properties of purified P. mirabilis mscL:

• Fluorescent dye efflux assay:

  • Liposomes loaded with self-quenching fluorescent dyes (calcein, carboxyfluorescein)

  • Channel activation measured as increased fluorescence upon dye release

  • Osmotic downshock used to create membrane tension

• Stopped-flow light scattering:

  • Measures liposome volume changes during osmotic shock

  • Can determine activation thresholds under various conditions

• Atomic force microscopy (AFM):

  • Direct measurement of force-induced conformational changes

  • Can correlate applied force with structural alterations

• Environmental sensitivity assays:

  • Testing channel activity under varying conditions (pH, temperature, ionic strength)

  • Particularly useful for comparative studies with mutant variants
    These methodologies should be calibrated using well-characterized mechanosensitive channels (such as E. coli MscL) to ensure reliability and enable comparative analysis.

Is there evidence linking mscL function to P. mirabilis virulence or pathogenicity?

While direct evidence specifically linking mscL to P. mirabilis virulence is limited in the current literature, several investigative approaches can be employed to explore this relationship:

• Gene knockout/knockdown studies:

  • Creation of mscL deletion mutants in P. mirabilis

  • Comparison of virulence factor expression between wild-type and mutant strains

  • In vitro infection models to assess colonization and persistence

• Expression analysis during infection:

  • Transcriptomic analysis of mscL expression during urinary tract infection (UTI) models

  • Comparison of expression levels under various environmental stresses mimicking host conditions
    The multicellular behavior of P. mirabilis, particularly its distinctive swarming motility, plays a crucial role in its pathogenicity and biofilm formation capability . Mechanosensitive channels could potentially influence these processes by responding to mechanical cues during surface colonization or by contributing to osmotic adaptation during infection.

How might mscL function contribute to P. mirabilis survival during urinary tract infections?

P. mirabilis is a significant cause of catheter-associated urinary tract infections (CAUTIs) , and mscL may contribute to bacterial survival in this environment through several mechanisms:

• Osmotic adaptation:

  • Urine composition fluctuates in osmolarity

  • MscL activation could prevent osmotic lysis during sudden dilution of urine

  • This protection mechanism may be particularly important during catheter irrigation procedures

• Biofilm formation:

  • P. mirabilis forms crystalline biofilms on catheters due to urease activity

  • Mechanosensitive responses could contribute to sensing surface attachment

  • Channel activity might influence the transition between planktonic and biofilm states

• Stress responses during host immune interactions:

  • Antimicrobial peptides from the host can create membrane stress

  • Mechanosensitive channels may contribute to bacterial survival during immune attack
    Research protocols to investigate these hypotheses should include:

• Growth and survival assays under artificial urine conditions with varying osmolarity

• Biofilm formation comparisons between wild-type and mscL mutant strains

• Membrane integrity assessment during exposure to host defense molecules

Does mscL expression correlate with the distinctive swarming behavior of P. mirabilis?

The relationship between mscL expression and P. mirabilis swarming behavior represents an intriguing research question:

• Potential mechanistic connections:

  • Swarming cells undergo significant morphological changes, including cell elongation

  • Membrane tension changes during this transformation could involve mechanosensitive channels

  • Surface sensing mechanisms might utilize mechanosensitive components

• Investigative approaches:

  • Transcriptomic analysis comparing swimmer versus swarmer cell types

  • Visualization of fluorescently tagged mscL during swarming transitions

  • Motility assays comparing wild-type to mscL mutants on surfaces of varying rigidity
    Recent studies have identified various genes influencing P. mirabilis swarming, including rffG which affects cell envelope formation . The relationship between envelope stress and mechanosensing represents a potentially important area for investigation, as proper cellular envelope formation is critical for swarming behavior.

What mutational strategies can reveal structure-function relationships in P. mirabilis mscL?

Systematic mutational analysis of P. mirabilis mscL can provide valuable insights into channel function:

• Key regions for targeted mutagenesis:

  • Transmembrane domains: Mutations affecting helix packing and gating

  • Cytoplasmic and periplasmic loops: Alterations to tension sensing

  • C-terminal domain: Mutations potentially affecting oligomerization or regulation

• Mutagenesis methodologies:

  • Site-directed mutagenesis targeting conserved residues

  • Alanine-scanning to identify critical functional regions

  • Chimeric constructs with other mechanosensitive channels to identify domain-specific functions

• Functional characterization of mutants:

  • Patch-clamp analysis to determine changes in gating tension and conductance

  • In vivo complementation assays in osmotic downshock survival models

  • Structural assessment of mutant proteins to correlate with functional changes
    The amino acid sequence (MAFFKEFREFAMKGNVVDMAVGVIIGAAFGKIVSSLVADVIMPPLGLLIGGIDFKQFSLVLREAHGDIPAVILNYGAFIQTVFDFAIVAFAIFCAIKLINKMRRQEEEQPKAPPAPSAEETTLLTEIRDLLKNQQK) provides the basis for identifying conserved regions between P. mirabilis mscL and better-characterized homologs to guide rational mutagenesis approaches.

How can biophysical methods elucidate the gating mechanism of P. mirabilis mscL?

Advanced biophysical approaches can provide detailed insights into the molecular mechanisms of P. mirabilis mscL gating:

• Single-molecule FRET (smFRET):

  • Strategic placement of fluorophore pairs to monitor conformational changes

  • Real-time observation of channel opening and closing events

  • Correlation of tension application with structural transitions

• Electron paramagnetic resonance (EPR) spectroscopy:

  • Site-directed spin labeling of strategic residues

  • Measurement of distances between labeled sites

  • Monitoring of conformational changes during gating

• High-speed atomic force microscopy:

  • Direct visualization of conformational changes in membrane-embedded channels

  • Correlation of applied force with structural alterations

• Molecular dynamics simulations:

  • Integration of experimental data into computational models

  • Prediction of energetics associated with channel gating

  • Identification of water and ion pathways through the channel
    These methods should be applied across a range of conditions (pH, temperature, lipid composition) to build a comprehensive model of channel gating mechanics.

What is the potential for targeting P. mirabilis mscL in antimicrobial development?

The exploration of P. mirabilis mscL as a potential antimicrobial target requires systematic investigation:

• Target validation approaches:

  • Assessment of bacterial survival with mscL inhibition under relevant stress conditions

  • Evaluation of species-specific differences between human and bacterial mechanosensitive channels

  • Determination of essentiality under infection-relevant conditions

• Screening methodologies:

  • Development of fluorescence-based high-throughput screening assays

  • Patch-clamp electrophysiology for secondary validation

  • In silico screening targeting identified gating regions

• Compound development considerations:

  • Specificity for bacterial over mammalian mechanosensitive channels

  • Penetration of bacterial outer membrane (particularly challenging for Gram-negative species)

  • Stability in infection-relevant environments (e.g., urinary tract)

• Potential antimicrobial mechanisms:

  • Locking channels in open state to promote cytoplasmic leakage

  • Preventing channel opening during osmotic stress

  • Disrupting oligomerization or membrane integration
    Given P. mirabilis's role in CAUTIs and the growing concern over antibiotic resistance , novel antimicrobial targets represent an important research direction, particularly for addressing biofilm-associated infections that are difficult to treat with conventional antibiotics.

What strategies can overcome expression and purification challenges with recombinant P. mirabilis mscL?

Membrane protein expression and purification frequently encounter obstacles that require systematic troubleshooting:

• Expression optimization:

  • Codon optimization for expression host

  • Evaluation of different fusion partners (SUMO, MBP) to enhance solubility

  • Testing induction parameters (temperature, inducer concentration, duration)

  • Screening multiple E. coli strains specialized for membrane protein expression

• Solubilization improvements:

  • Systematic detergent screening (DDM, LDAO, OG, LMNG)

  • Lipid addition during solubilization

  • Detergent-lipid mixed micelles for improved stability

• Purification refinements:

  • Buffer optimization to reduce aggregation

  • Addition of stabilizing agents (glycerol, specific lipids)

  • Gentle elution conditions from affinity columns

• Storage stability:

  • Optimal glycerol concentration (typically 50%)

  • Addition of reducing agents if cysteine residues are present

  • Determination of ideal pH and ionic strength
    When significant challenges persist, consider alternative expression systems such as cell-free protein synthesis, which can sometimes overcome toxicity or folding issues encountered in cellular systems.

How can researchers distinguish between functional and non-functional mscL protein preparations?

Distinguishing functional from non-functional protein preparations is critical for reliable research outcomes:

What are the critical parameters for successful reconstitution of P. mirabilis mscL into artificial membranes?

Successful reconstitution of functional mscL channels requires optimization of several key parameters:

• Lipid composition considerations:

  • E. coli polar lipid extract provides a native-like environment

  • POPE:POPG mixtures (70:30) often yield good channel activity

  • Cholesterol inclusion can modify channel gating tension

• Protein-to-lipid ratio optimization:

  • Typical range: 1:50 to 1:1000 (w/w)

  • Higher ratios for structural studies

  • Lower ratios for single-channel electrophysiology

• Reconstitution method selection:

  • Detergent dialysis: Gentle but time-consuming

  • Bio-bead mediated detergent removal: Faster but requires optimization

  • Direct incorporation into preformed liposomes: Simpler but less efficient

• Critical quality control steps:

  • Dynamic light scattering to verify liposome size distribution

  • Freeze-fracture electron microscopy to confirm protein incorporation

  • Functional assays to verify channel activity post-reconstitution
    The reconstitution buffer should be carefully optimized, typically containing 10-20 mM HEPES (pH 7.0-7.5), 150 mM KCl or NaCl, and potentially small amounts of divalent cations depending on the specific experimental requirements.

How does P. mirabilis mscL compare with mechanosensitive channels from other pathogenic bacteria?

Comparative analysis provides valuable insights into conservation and specialization of mechanosensitive channels across bacterial species:

• Sequence conservation patterns:

  • Transmembrane domains show highest conservation

  • C-terminal regions display greater variability

  • Gating region residues highly conserved across species

• Functional comparative analysis:

  • Gating tension thresholds vary between species

  • Conductance properties generally conserved

  • Regulatory mechanisms may differ significantly

• Structural variations:

  • Oligomeric state typically pentameric but exceptions exist

  • N- and C-terminal domains show greatest structural divergence

  • Species-specific interactions with surrounding lipids
    Given P. mirabilis's distinctive multicellular behaviors and specialized niche as a urinary tract pathogen , comparative studies may reveal adaptations in its mechanosensitive systems that contribute to its specialized lifestyle and virulence mechanisms.

What evolutionary insights can be gained from studying P. mirabilis mscL?

Evolutionary analysis of mscL channels can provide broader insights into bacterial adaptation:

• Phylogenetic analysis approaches:

  • Multiple sequence alignment of mscL homologs across bacterial phyla

  • Identification of conserved versus rapidly evolving regions

  • Correlation with bacterial lifestyle (pathogenic vs. non-pathogenic)

• Selective pressure analysis:

  • Calculation of Ka/Ks ratios to identify positively selected residues

  • Mapping of evolutionary constraints onto structural models

  • Correlation with functional domains

• Horizontal gene transfer assessment:

  • Comparison of mscL gene trees with species phylogeny

  • Analysis of genomic context and GC content

  • Identification of potential lateral transfer events
    P. mirabilis belongs to the Enterobacteriaceae family , allowing for particularly informative comparisons with well-studied members like E. coli, potentially highlighting adaptations specific to its unique ecological niche and pathogenic lifestyle.

Can heterologous expression of P. mirabilis mscL complement mscL-deficient strains of other bacteria?

Functional complementation studies provide powerful insights into conservation of mechanism and potential species-specific adaptations:

• Experimental design considerations:

  • Generation of clean mscL deletion in model organisms (E. coli, B. subtilis)

  • Expression of P. mirabilis mscL under native or inducible promoters

  • Assessment of complementation under various osmotic stress conditions

• Phenotypic assays:

  • Survival during hypoosmotic shock

  • Growth curves under various osmotic conditions

  • Electrophysiological characterization of heterologously expressed channels

• Structure-function relationship studies:

  • Creation of chimeric channels with domain swaps

  • Identification of species-specific functional domains

  • Correlation with environmental adaptations This approach can reveal the degree of functional conservation across species and identify potential specialized adaptations in P. mirabilis mscL that might relate to its pathogenic lifestyle, particularly in the context of urinary tract infections where osmotic fluctuations occur.