Recombinant Proteus mirabilis NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
nuoA; PMI1762; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Proteus mirabilis (strain HI4320)
Target Names
nuoA
Target Protein Sequence
MSMSTTTEVIAHYWAFAVFLIGALGLCSLMLLGARYLGGRAQARAKHVPYESGLDSVGSA RLRMSAKFYLVAMFFVIFDVEALFLYAWAVSVREVGWLGFIEAAVFIAILLAGLFYLVRI GALNWTPVRSRRETAGKSHVRLTSGKHPQQ
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this species, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy in a proton gradient.

Database Links

KEGG: pmr:PMI1762

STRING: 529507.PMI1762

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of NADH-quinone oxidoreductase (Complex I) in Proteus mirabilis?

NADH-quinone oxidoreductase (Complex I) plays a crucial role in bacterial energy metabolism by catalyzing electron transfer from NADH to quinones in the respiratory chain. In bacteria, Complex I is widespread, being found in approximately 52% of analyzed bacterial genomes . While the specific function of Complex I in Proteus mirabilis has not been fully characterized, comparative analysis with other bacteria suggests it likely contributes to energy generation during both aerobic and anaerobic respiration.

Unlike Escherichia coli, where Complex I is not required for aerobic respiration but is essential for anaerobic fumarate respiration, or Rhodobacter capsulatus, where it catalyzes the reverse reaction during phototrophic growth, P. mirabilis likely utilizes Complex I to support its distinctive energy-intensive behaviors such as swarming motility . The nuoA subunit, as part of the membrane domain of Complex I, contributes to the proton translocation machinery that generates proton motive force essential for ATP synthesis.

How is the nuoA gene organized within the Proteus mirabilis genome?

The nuoA gene in P. mirabilis is part of the nuo operon encoding the 14 subunits of the proton-translocating NADH:quinone oxidoreductase (Complex I). Based on genomic analysis of multiple bacterial species, the genes encoding Complex I (nuoA to nuoN) are typically colocalized in 86% of bacterial genomes where the enzyme is found . This colocalization pattern suggests they may form a polycistronic operon similar to that observed in Escherichia coli.

The organization of the nuo operon is particularly significant for expression studies, as understanding the native gene arrangement helps in designing constructs for recombinant expression that maintain proper stoichiometry and assembly of the complex.

GenePosition in OperonFunction
nuoATypically near 5' endMembrane subunit involved in proton translocation
nuoB-NDownstream of nuoAVarious functions in electron transfer and proton pumping

What expression systems are most effective for producing recombinant P. mirabilis nuoA?

When expressing recombinant P. mirabilis nuoA, researchers should consider several methodological approaches:

E. coli-based expression systems:

  • BL21(DE3) strain: Offers high expression levels with T7 promoter-based vectors

  • C41(DE3) or C43(DE3) strains: Specially designed for membrane protein expression, potentially more suitable for nuoA

  • Codon optimization: Essential when expressing P. mirabilis genes in E. coli due to potential codon usage bias

Expression optimization protocol:

  • Culture cells at lower temperatures (16-25°C) after induction to reduce inclusion body formation

  • Use lower inducer concentrations (0.1-0.5 mM IPTG) for gentler induction

  • Consider fusion tags like MBP (maltose-binding protein) to enhance solubility

  • For membrane integration studies, the pBAD system with arabinose induction offers finer control over expression levels

Testing multiple expression conditions is critical, as membrane proteins like nuoA often present challenges in recombinant expression systems.

How can researchers validate the function of recombinantly expressed P. mirabilis nuoA?

Functional validation of recombinant nuoA requires multiple complementary approaches:

  • Complementation assays: Transform nuoA-deletion mutants with the recombinant nuoA to assess restoration of Complex I activity

  • NADH:quinone oxidoreductase activity assays: Measure electron transfer rates using purified recombinant protein reconstituted in liposomes

  • Membrane potential measurements: Use fluorescent dyes like DiSC3(5) to assess proton pumping activity

  • Protein-protein interaction studies: Employ techniques such as bacterial two-hybrid systems or pull-down assays to verify correct interaction with other Complex I subunits

  • Growth phenotype analysis: Compare growth rates under different respiratory conditions (aerobic vs. anaerobic) between wild-type, nuoA mutants, and complemented strains

A comprehensive functional validation should incorporate multiple techniques to establish both structural integration and enzymatic activity of the recombinant protein.

How can researchers address data contradictions when studying P. mirabilis nuoA function?

When experimental data contradicts hypotheses about P. mirabilis nuoA function, researchers should implement a systematic troubleshooting approach:

  • Thoroughly examine the data to identify specific discrepancies between expected and observed results

  • Evaluate initial assumptions about protein function, considering that nuoA may have evolved unique functions in P. mirabilis compared to model organisms

  • Consider alternative explanations for contradictory results, such as:

    • Post-translational modifications affecting protein function

    • Interactions with P. mirabilis-specific factors not present in heterologous systems

    • Differences in membrane composition affecting integration and function

  • Modify experimental design by implementing additional controls:

    • Include positive controls using well-characterized Complex I subunits from model organisms

    • Perform parallel experiments with homologous proteins from related species

    • Consider the impact of Proteus mirabilis' unique physiology, particularly its swarming behavior and urease activity

  • Refine variables and implement additional controls, particularly when studying nuoA in the context of P. mirabilis virulence or biofilm formation

Approaching contradictory data as an opportunity for discovery rather than an experimental failure can lead to identification of novel functions or regulatory mechanisms.

What methodologies are appropriate for studying the role of nuoA in P. mirabilis pathogenesis?

Investigating nuoA's potential role in P. mirabilis pathogenesis requires specialized methodologies:

  • Generation of nuoA mutants:

    • Use allelic exchange techniques to create clean deletion mutants

    • Employ CRISPR-Cas9 systems adapted for P. mirabilis

  • In vitro infection models:

    • Uroepithelial cell culture systems to assess adhesion and invasion

    • Biofilm formation assays on catheter materials

    • Co-culture systems with neutrophils to examine interaction with immune cells

  • In vivo infection models:

    • Murine models of ascending urinary tract infections

    • Catheter-associated UTI models

    • Polymicrobial infection models that mimic clinical scenarios

  • Specialized assays for virulence factor assessment:

    • Swarming motility assays on agar plates

    • Urease activity measurements

    • Assessment of resistance to neutrophil extracellular traps (NETs)

A comparative approach analyzing wild-type, nuoA mutant, and complemented strains across these platforms can reveal how energy metabolism through Complex I influences virulence processes.

How might nuoA interact with P. mirabilis metal acquisition systems during infection?

The potential interaction between nuoA and P. mirabilis metal acquisition systems represents an intriguing research direction:

Experimental approach for investigating metal-nuoA interactions:

  • Metal-dependent activity assays:

    • Measure nuoA/Complex I activity under varying concentrations of different metals

    • Determine whether metal transport mutants (znuACB, ynt, nik) affect Complex I function

  • Transcriptional analysis:

    • Perform RNA-seq comparing expression of nuoA and metal transport genes under metal-limited conditions

    • Use reporter constructs to monitor nuoA expression in response to metal availability

  • Protein interaction studies:

    • Investigate potential interactions between nuoA and metal transport proteins like ZnuACB, YntA, or NikA

    • Use techniques such as bacterial two-hybrid or proximity labeling methods

The interconnection between energy metabolism and metal acquisition may be particularly relevant in the urinary tract environment, where both P. mirabilis metal acquisition systems (YntA and NikA for nickel; ZnuACB for zinc) and energy generation are crucial for colonization and infection .

Metal Acquisition SystemFunctionPotential Interaction with Complex I
YntA/NikAPrimary nickel import for urease activityMay influence energy-dependent metal transport
ZnuACBZinc uptake system upregulated during UTIsZinc availability may affect Complex I assembly or function

What approaches can be used to investigate the relationship between nuoA and swarming motility in P. mirabilis?

P. mirabilis exhibits distinctive swarming motility that requires significant energy expenditure, suggesting a potential link to Complex I function through nuoA:

  • Phenotypic characterization:

    • Compare swarming patterns between wild-type and nuoA mutants

    • Analyze flagellar gene expression and flagellin production in nuoA mutants

    • Examine cell morphology during differentiation to swarmer cells

  • Metabolic analysis:

    • Measure cellular ATP levels during swarming in wild-type vs. nuoA mutants

    • Analyze NADH/NAD+ ratios during different phases of swarming

    • Use metabolic flux analysis to determine carbon utilization patterns

  • Real-time visualization:

    • Employ time-lapse microscopy with fluorescently labeled nuoA to track localization during swarmer cell differentiation

    • Use membrane potential-sensitive dyes to monitor energy status during swarming

  • Genetic interaction studies:

    • Create double mutants in nuoA and known swarming regulators

    • Perform transposon mutagenesis in nuoA background to identify suppressors

Given that P. mirabilis undergoes a morphological conversion to filamentous swarmer cells expressing hundreds of flagella , the energy provided by properly functioning Complex I may be critical for this energy-intensive process.

How can structural biology approaches advance understanding of P. mirabilis nuoA function?

Advanced structural biology methodologies offer powerful tools for investigating nuoA:

  • Cryo-electron microscopy (cryo-EM):

    • Determine the structure of P. mirabilis Complex I with focus on nuoA

    • Compare with known structures from model organisms to identify unique features

    • Visualize conformational changes during the catalytic cycle

  • X-ray crystallography of recombinant nuoA:

    • Express and purify nuoA with stabilizing fusion partners

    • Perform crystallization trials under various conditions

    • Determine high-resolution structure to identify functional motifs

  • Molecular dynamics simulations:

    • Model nuoA within the lipid bilayer

    • Simulate proton translocation mechanisms

    • Investigate potential interaction sites with other Complex I subunits

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map dynamic regions and conformational changes in nuoA

    • Identify regions involved in protein-protein interactions

    • Examine structural impacts of disease-associated mutations

Structural insights can guide the design of specific inhibitors targeting P. mirabilis Complex I as potential therapeutic agents for treating UTIs caused by this pathogen.

What are the most effective methods for optimizing purification of recombinant P. mirabilis nuoA?

Purification of recombinant membrane proteins like nuoA presents significant challenges that require specialized approaches:

  • Membrane extraction optimization:

    • Test multiple detergents (DDM, LMNG, CHAPS) at varying concentrations

    • Employ gentle solubilization conditions to maintain native conformation

    • Consider nanodisc or styrene maleic acid lipid particle (SMALP) approaches for detergent-free extraction

  • Affinity chromatography:

    • Utilize tandem affinity tags (His-MBP or His-SUMO) for improved purity

    • Implement on-column detergent exchange during purification

    • Optimize imidazole gradients to minimize co-purification of contaminants

  • Size exclusion chromatography:

    • Select appropriate column matrices for membrane protein separation

    • Analyze oligomeric state under different detergent conditions

    • Confirm homogeneity through dynamic light scattering

  • Functional validation of purified protein:

    • Conduct spectroscopic analysis to confirm proper folding

    • Measure specific activity to ensure functional integrity

    • Perform thermal stability assays to optimize buffer conditions

Purification success can be monitored by tracking protein yield, purity, and retention of specific activity at each purification step.

How should researchers approach the design of site-directed mutagenesis experiments for P. mirabilis nuoA?

Strategic design of mutagenesis experiments can provide valuable insights into nuoA function:

Systematic mutagenesis approaches can map functionally important regions of nuoA and provide insights into how it contributes to P. mirabilis energy metabolism and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.