Recombinant Proteus mirabilis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
nuoK; PMI1753; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Proteus mirabilis (strain HI4320)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAVLFVLGFTCLVLRRNLLFMLIGLEIMINSAALAFVVGGSYWGQTDGQI MYILAISLAAAEASIGLALLLQLHRHRQNLNIDTVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. The enzyme couples this redox reaction to proton translocation across the cytoplasmic membrane; four protons are translocated for every two electrons transferred, thus conserving energy in a proton gradient.
Database Links

KEGG: pmr:PMI1753

STRING: 529507.PMI1753

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase in Proteus mirabilis and how does it relate to complex II?

NADH-quinone oxidoreductase (Complex I) and succinate:quinone oxidoreductase (Complex II) are distinct respiratory chain components in Proteus mirabilis. While Complex II has been extensively characterized as a 116.5 kDa protein consisting of three subunits (19 kDa, 29 kDa, and 68.5 kDa) , NADH-quinone oxidoreductase is a larger complex containing multiple subunits including the nuoK subunit. Both complexes play crucial roles in electron transport and energy generation, but they accept electrons from different sources - NADH for Complex I and succinate for Complex II. Understanding these distinctions is essential when designing experiments targeting specific respiratory chain components.

How does the genomic conservation of Proteus mirabilis affect research on specific proteins like nuoK?

Proteus mirabilis exhibits remarkable chromosomal conservation across different strains. Comparative genomic analyses show that the majority of predicted proteins are at least 99% identical across diverse strains . This conservation suggests that research findings on nuoK from one strain may likely apply to other strains. When designing recombinant protein experiments, researchers should consider this genomic stability while remaining aware of potential strain-specific variations. The high degree of synteny observed between fully annotated P. mirabilis genomes (e.g., HI4320 and BB2000) indicates that gene localization and context is also likely conserved .

What techniques are most effective for initial identification of nuoK expression in clinical isolates of Proteus mirabilis?

For initial identification of nuoK expression in clinical isolates, a multi-technique approach is recommended:

TechniqueApplicationAdvantagesLimitations
RT-PCRmRNA detectionHigh sensitivity, quantifiableDoesn't confirm protein expression
Western blotProtein detectionDirectly confirms protein presenceRequires specific antibodies
Activity assaysFunctional confirmationVerifies enzymatic functionMay reflect activity of whole complex
Proteomic analysisComprehensive protein identificationIdentifies multiple components simultaneouslyRequires specialized equipment

When working with clinical isolates, consistently using standardized extraction protocols is critical for comparable results across samples. Unlike some specialized or hypervariable components, respiratory chain elements are typically highly conserved and expressed across strains .

What expression systems work best for producing functional recombinant Proteus mirabilis nuoK?

When selecting an expression system for recombinant Proteus mirabilis nuoK, consider these methodological approaches:

The key methodological consideration is maintaining the native conformation of nuoK. Similar to the approach used for Complex II isolation , expression constructs should include appropriate tags that don't interfere with membrane insertion or protein folding. Purification protocols similar to those used for Complex II isolation can be adapted, employing ion-exchange chromatography followed by gel filtration, with modifications to accommodate the different physicochemical properties of nuoK.

How can researchers overcome challenges in membrane protein solubilization when working with nuoK?

Membrane protein solubilization represents a significant challenge in nuoK research. Based on methodologies applied to similar respiratory proteins from Proteus mirabilis, researchers should consider:

  • Detergent screening: Systematically test multiple detergents (DDM, LDAO, C12E8) at varying concentrations to identify optimal solubilization conditions.

  • Lipid supplementation: Addition of specific phospholipids during solubilization can maintain protein stability and function.

  • Temperature optimization: Conduct solubilization at lower temperatures (4-16°C) to reduce protein aggregation.

  • Stepwise purification: Similar to techniques used for Complex II purification , implement a multi-stage purification process with gentle buffer transitions.

The methodology should be validated by assessing protein functionality through activity assays measuring electron transfer capabilities, similar to how succinate:quinone oxidoreductase activity is measured in Proteus mirabilis .

What purification strategy yields the highest purity and activity for recombinant nuoK?

Based on successful purification strategies for respiratory complexes from Proteus mirabilis, a multi-step approach is recommended:

Purification StepPurposeCritical Parameters
Affinity chromatographyInitial captureBuffer compatibility with membrane proteins
Ion-exchange chromatographyIntermediate purificationpH and salt gradient optimization
Gel filtrationFinal polishingDetergent concentration maintenance

The purification protocol should be optimized to maintain the structural integrity of nuoK throughout the process. Monitoring protein activity at each purification stage is essential to ensure functionality is preserved. When adapting methods used for Complex II purification , researchers should modify salt concentrations and detergent types based on the specific physicochemical properties of nuoK.

How should researchers address data that contradicts expected nuoK characteristics?

When facing contradictory data regarding nuoK characteristics:

  • Thoroughly examine the data: Identify specific discrepancies between expected results and actual findings. Pay particular attention to outliers that may significantly influence results .

  • Evaluate initial assumptions: Consider whether your hypothesis about nuoK function or structure was based on incomplete information or cross-species extrapolation that may not apply to Proteus mirabilis.

  • Review methodology: Assess whether experimental conditions, particularly detergent selection, buffer composition, or expression system, could have altered protein characteristics.

  • Consider alternative explanations: Proteus mirabilis is known for strain variability in certain characteristics ; evaluate whether strain-specific variations could explain unexpected results.

  • Design validation experiments: Implement orthogonal techniques to confirm unexpected findings, such as combining spectroscopic, biochemical, and structural approaches.

Remember that unexpected findings often lead to new discoveries. The complex II characteristics identified in Proteus mirabilis (9.5 nmoles of cytochrome b per mg protein with specific absorption peaks) were novel findings that advanced understanding of bacterial respiratory chains.

What statistical approaches are most appropriate for analyzing nuoK activity data across different experimental conditions?

When analyzing nuoK activity data:

  • Normalization strategies: Normalize activity data to protein concentration, membrane content, or internal standards to ensure comparability across experiments.

  • Appropriate statistical tests:

    • ANOVA for comparing multiple experimental conditions

    • Repeated measures analysis for time-course experiments

    • Non-parametric tests when data doesn't follow normal distribution

  • Handling variability: Membrane protein studies often show higher variability than soluble protein research. Increase technical and biological replicates (minimum n=5) to account for this inherent variability.

  • Data visualization: Employ box plots or violin plots rather than simple bar graphs to better represent data distribution and variability.

The methodological approach should include rigorous controls and standardization procedures similar to those used in Complex II activity measurements from Proteus mirabilis .

How does nuoK contribute to the pathogenicity of Proteus mirabilis in urinary tract infections?

The relationship between respiratory chain components and Proteus mirabilis pathogenicity represents an advanced research area:

  • Metabolic adaptation: NADH-quinone oxidoreductase likely plays a crucial role in energy generation during infection, particularly in oxygen-limited environments of the urinary tract.

  • Survival under stress conditions: During neutrophil attack and NET (Neutrophil Extracellular Trap) formation in UTIs , respiratory chain efficiency may determine bacterial persistence.

  • Biofilm formation: Energy production through respiratory chain components potentially supports the metabolically demanding process of biofilm formation on catheters.

Investigating these connections requires methodological approaches that bridge in vitro biochemistry with in vivo infection models. Researchers should consider developing nuoK knockout mutants and assessing their fitness in mouse models of urinary tract infection, similar to approaches used to study other Proteus mirabilis virulence factors .

What structural features distinguish Proteus mirabilis nuoK from homologs in other bacterial species?

Comparative structural analysis methodology should include:

  • Homology modeling: Construct models based on known structures from related species, with careful attention to membrane-spanning regions.

  • Site-directed mutagenesis: Systematically alter conserved and divergent residues to identify functionally important regions.

  • Chimeric protein construction: Create fusion proteins with segments from different species to identify regions responsible for specific characteristics.

  • Cryo-EM analysis: Consider structural determination of the entire NADH-quinone oxidoreductase complex to understand nuoK in its native context.

This research direction can provide insights into potential species-specific properties that might be relevant to Proteus mirabilis pathogenicity or antimicrobial resistance mechanisms .

How does nuoK interact with other respiratory chain components in the context of antimicrobial resistance?

Given the emerging antimicrobial resistance in Proteus mirabilis, particularly extended-spectrum β-lactamases (ESBLs) and carbapenemases , understanding respiratory chain components' role in resistance mechanisms is crucial:

  • Metabolic adaptation: Investigate whether alterations in nuoK expression or function correlate with resistance phenotypes.

  • Drug-target interactions: Assess whether antibiotics targeting other cellular processes indirectly affect nuoK function or expression.

  • Compensatory mechanisms: Determine if resistant strains show altered respiratory chain composition to maintain fitness.

Methodological approaches should combine transcriptomic and proteomic analyses of resistant versus susceptible strains, with specific focus on respiratory chain components. Similar to the comprehensive analysis of virulence factors in Proteus mirabilis , researchers should consider system-level approaches to understand nuoK in the context of the bacterial response to antimicrobial pressure.

What opportunities exist for targeting nuoK in novel therapeutic approaches against Proteus mirabilis infections?

Developing therapeutic approaches targeting nuoK requires:

  • Inhibitor screening methodology: Establish high-throughput screening systems for compounds that specifically inhibit Proteus mirabilis nuoK without affecting human homologs.

  • Structure-based drug design: Utilize structural information to identify unique binding pockets or conformational states specific to bacterial nuoK.

  • Combination therapy approaches: Investigate synergistic effects between respiratory chain inhibitors and conventional antibiotics.

The methodological approach should include validation in both biochemical assays and infection models. Given the role of Proteus mirabilis in catheter-associated UTIs , researchers should also consider how nuoK inhibitors might be incorporated into catheter materials to prevent biofilm formation.

How might systems biology approaches enhance our understanding of nuoK function in Proteus mirabilis?

Systems biology methodology for nuoK research should include:

ApproachApplication to nuoK ResearchExpected Insights
Multi-omics integrationCorrelate transcriptomics, proteomics, and metabolomics dataIdentify regulatory networks controlling nuoK expression
Flux balance analysisModel energy metabolism with modified nuoK parametersPredict metabolic consequences of nuoK alterations
Protein-protein interaction networksMap interactions between nuoK and other cellular componentsDiscover unexpected functional relationships
In silico modelingSimulate respiratory chain function under various conditionsPredict behavior under physiological and stress conditions

This comprehensive approach can contextualize nuoK within the broader adaptive responses of Proteus mirabilis, particularly during infection and exposure to environmental stresses. Researchers should build on the genomic conservation data to develop species-specific models that accurately reflect Proteus mirabilis metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.