Recombinant Proteus mirabilis Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Proteus mirabilis Probable 4-Amino-4-Deoxy-L-Arabinose-Phosphoundecaprenol Flippase Subunit ArnE (arnE) is a protein involved in the Arn LPS modification system, a critical mechanism for antimicrobial resistance in Gram-negative bacteria. ArnE functions as a subunit of a heterodimeric flippase complex (ArnE-ArnF) that transports lipid-linked L-Ara4N (4-amino-4-deoxy-L-arabinose) across the inner membrane . This modification enables bacteria to resist cationic antimicrobial peptides (CAMPs) like polymyxins by neutralizing the negative charge of lipid A in lipopolysaccharides (LPS) .

Gene and Protein Structure

  • Gene locus: arnE is part of the arnBCADTEF operon in Proteus mirabilis .

  • Protein features:

    • Accession: Q7UC61 (UniProt) .

    • Length: 111 amino acids .

    • Domains: Predicted transmembrane helices consistent with flippase activity .

Recombinant Expression

Recombinant ArnE is produced in Escherichia coli with an N-terminal His tag for purification . Key specifications include:

ParameterDetail
Expression HostEscherichia coli
TagN-terminal His tag
Amino Acid Range1–111
Molecular Weight~13 kDa (theoretical)

LPS Modification and Antibiotic Resistance

ArnE works with ArnF to flip undecaprenyl phosphate-α-L-Ara4N from the cytoplasmic to the periplasmic side of the inner membrane . This enables ArnT (a glycosyltransferase) to attach L-Ara4N to lipid A, conferring resistance to polymyxins and zeamines .

Key findings:

  • Deletion of arnE in Dickeya oryzae EC1 reduces polymyxin B resistance by >300-fold .

  • In Salmonella enterica, ArnE-ArnF disruption prevents L-Ara4N incorporation into LPS, increasing susceptibility to CAMPs .

Virulence Modulation

ArnE indirectly influences virulence by regulating capsular polysaccharide synthesis and motility genes . In D. oryzae, arnE mutants exhibit reduced pathogenicity in plants like rice and Chinese cabbage .

Clinical Relevance

  • Antimicrobial resistance (AMR): ArnE-mediated LPS modification is a biomarker for polymyxin resistance in Proteus mirabilis .

  • Therapeutic targeting: Disrupting ArnE-ArnF function could resensitize bacteria to last-resort antibiotics like colistin .

Biotechnological Use

Recombinant ArnE serves as a tool for:

  • Studying LPS biosynthesis in Proteus spp.

  • High-throughput screening of flippase inhibitors .

Challenges

  • Functional complexity: ArnE requires ArnF for activity, complicating in vitro reconstitution .

  • Regulatory interplay: ArnE expression is co-regulated with other AMR genes (e.g., blaCTX-M) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; PMI1048; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Proteus mirabilis (strain HI4320)
Target Names
arnE
Target Protein Sequence
MAFFLLLIVSLLTCIGQVCQKQAVVSWQNNSTTKARKTIFWLITAIAMLGFGMLFWLRLL QILPLSIAYPMLSINFIVVTLIGQFIYKETVNVKHWVGIASIMLGIVLMSMQS
Uniprot No.

Target Background

Function
Translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links

KEGG: pmr:PMI1048

STRING: 529507.PMI1048

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of ArnE in Proteus mirabilis?

ArnE (previously designated as PmrM) functions as a critical subunit of an undecaprenyl phosphate-α-L-Ara4N flippase, working in conjunction with ArnF (formerly PmrL). This heterodimeric complex is responsible for transporting the undecaprenyl phosphate-α-L-Ara4N molecule from the cytosolic side to the periplasmic side of the inner bacterial membrane . This translocation is essential for the subsequent modification of lipopolysaccharide (LPS) with 4-amino-4-deoxy-L-arabinose (L-Ara4N), a process that significantly contributes to antimicrobial peptide resistance in various Gram-negative bacteria .

The functional significance of ArnE has been demonstrated through knockout studies, where mutations in the gene encoding this protein result in polymyxin-sensitive phenotypes despite normal biosynthesis of undecaprenyl phosphate-α-L-Ara4N . Specifically, mutant strains show reduced concentration of undecaprenyl phosphate-α-L-Ara4N on the periplasmic surface of the inner membrane, as evidenced by decreased labeling with inner membrane-impermeable amine reagents such as N-hydroxysulfosuccinimidobiotin .

How does ArnE contribute to antibiotic resistance in P. mirabilis?

ArnE contributes to antibiotic resistance in P. mirabilis through its essential role in the L-Ara4N modification pathway of lipid A. This modification pathway represents a key mechanism by which P. mirabilis and other Gram-negative bacteria develop resistance to cationic antimicrobial peptides, including polymyxins that serve as last-resort antibiotics for challenging Gram-negative infections .

The mechanism operates as follows:

  • ArnE, together with ArnF, flips undecaprenyl phosphate-α-L-Ara4N from the cytoplasm to the periplasmic face of the inner membrane

  • ArnT then transfers the L-Ara4N moiety to lipid A in the periplasm

  • The addition of L-Ara4N neutralizes the negative charge of lipid A, reducing the electrostatic attraction between cationic antimicrobial peptides and the bacterial outer membrane

  • This modification creates a physical barrier that prevents antimicrobial peptides from disrupting membrane integrity

The emergence of multidrug-resistant (MDR) P. mirabilis strains, particularly those expressing extended-spectrum β-lactamases (ESBLs) and carbapenemases, represents a significant clinical challenge . The L-Ara4N modification system including ArnE plays a crucial role in this resistance profile, especially as colistin (polymyxin E) has become a last-resort treatment option for infections caused by multidrug-resistant Gram-negative bacteria .

What are the recommended methods for recombinant expression of P. mirabilis ArnE?

For effective recombinant expression of P. mirabilis ArnE, the following methodological approach is recommended:

Expression System Selection:

  • E. coli BL21(DE3) or C43(DE3) strains are preferred for membrane protein expression

  • pET series vectors (particularly pET28a) with an N-terminal His6-tag facilitate purification

  • Consider using a codon-optimized synthetic gene to overcome potential rare codon issues

Expression Protocol:

  • Transform the expression construct into the chosen E. coli strain

  • Grow cultures in Terrific Broth (TB) medium at 37°C until OD600 reaches 0.6-0.8

  • Cool cultures to 18-20°C before induction

  • Induce with 0.5 mM IPTG

  • Continue expression at 18-20°C for 16-20 hours to minimize inclusion body formation

Membrane Fraction Isolation:

  • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

  • Disrupt cells using French press or sonication

  • Remove cell debris by centrifugation (10,000 × g, 30 min, 4°C)

  • Ultracentrifuge the supernatant (100,000 × g, 1 hour, 4°C) to isolate membrane fractions

  • Solubilize membrane proteins using 1% n-dodecyl β-D-maltoside (DDM) or 1% n-decyl-β-D-maltopyranoside (DM)

Purification Strategy:

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Include 0.05% DDM in all purification buffers to maintain protein solubility

  • Consider size exclusion chromatography as a polishing step

This approach has been successfully adapted from methods used for homologous proteins in related bacterial species, including the ArnE homolog in Salmonella enterica .

How can researchers effectively detect and measure ArnE flippase activity?

Measuring the flippase activity of ArnE presents technical challenges due to the membrane-embedded nature of the protein and the complex substrate. The following methodological approaches can be employed:

1. Membrane Impermeant Chemical Labeling Assay:

  • Principle: Differential labeling of undecaprenyl phosphate-α-L-Ara4N on the periplasmic face of the membrane

  • Protocol:

    • Isolate bacterial membrane vesicles from wild-type and arnE-mutant strains

    • Treat with membrane-impermeable amine reagent such as N-hydroxysulfosuccin-imidobiotin (Sulfo-NHS-biotin)

    • Extract lipids and analyze the labeled undecaprenyl phosphate-α-L-Ara4N by thin-layer chromatography (TLC)

    • Quantify biotin-labeled compounds using streptavidin-HRP detection

    • Compare labeling intensity between wild-type and mutant samples

2. Reconstituted Proteoliposome Assay:

  • Principle: Direct measurement of substrate translocation across membrane bilayers

  • Protocol:

    • Purify recombinant ArnE and ArnF proteins

    • Reconstitute the proteins into proteoliposomes with defined phospholipid composition

    • Load proteoliposomes with fluorescently labeled undecaprenyl phosphate-α-L-Ara4N analogs

    • Monitor substrate translocation using fluorescence quenching assays

    • Calculate flippase activity based on fluorescence changes over time

3. Polymyxin Resistance Complementation Assay:

  • Principle: Functional complementation of ArnE-deficient strains

  • Protocol:

    • Generate arnE knockout strain with polymyxin-sensitive phenotype

    • Transform with plasmids expressing wild-type or mutant ArnE variants

    • Determine minimum inhibitory concentrations (MICs) for polymyxin B

    • Assess restoration of resistance as a proxy for ArnE function

Data Analysis and Controls:

  • Include arnF knockouts as comparative controls

  • Use arnT knockouts to distinguish effects on flipping versus L-Ara4N transfer

  • Employ chemical inhibitors of lipid flippases as negative controls

  • Normalize activity measurements to protein expression levels

These methodologies provide complementary approaches to assess ArnE function, with the chemical labeling assay being particularly valuable as it has been validated in previous studies of ArnE homologs .

What is the predicted membrane topology of P. mirabilis ArnE and how can it be experimentally verified?

Based on homology with characterized ArnE proteins from related species, P. mirabilis ArnE is predicted to have a complex membrane topology comprising multiple transmembrane domains. According to studies on homologous proteins:

Predicted Topology:

  • 13 transmembrane helices spanning the inner membrane

  • Large C-terminal domain exposed to the periplasm

  • Several short loops connecting the transmembrane segments on both cytoplasmic and periplasmic sides

Experimental Verification Methods:

1. PEGylation Assay:

  • Generate a cysteine-less version of ArnE as a background construct

  • Introduce single cysteine residues at predicted loop regions

  • Treat with membrane-permeable (N-hydroxysuccinimidobiotin) and membrane-impermeable (Sulfo-NHS-biotin) cysteine-reactive reagents

  • Analyze by SDS-PAGE to determine accessibility of each cysteine

  • The pattern of accessibility will reveal which regions are exposed to which side of the membrane

2. Substituted Cysteine Accessibility Method (SCAM):

  • Similar to PEGylation but uses methanethiosulfonate (MTS) reagents

  • Sequential testing of cysteine mutants throughout the protein

  • Differential labeling with membrane-permeable and impermeable MTS reagents

  • Analysis by mass spectrometry to identify labeled positions

3. GFP Fusion Analysis:

  • Create truncated ArnE constructs fused to GFP

  • Analyze fluorescence localization in bacterial spheroplasts

  • Cytoplasmic GFP gives diffuse fluorescence; periplasmic GFP is concentrated at the membrane

4. Protease Protection Assay:

  • Prepare inverted and right-side-out membrane vesicles

  • Treat with proteases (trypsin or chymotrypsin)

  • Analyze protected fragments by Western blotting using domain-specific antibodies

  • Compare digestion patterns to determine exposed regions

The combination of these approaches would provide a comprehensive experimental validation of the ArnE topology model, similar to the approach used for Burkholderia cenocepacia ArnT, which revealed a 13-transmembrane helix configuration with a large C-terminal periplasmic domain .

Which conserved motifs and critical residues in ArnE are essential for its function?

Studies on homologous ArnE proteins from related bacterial species have identified several highly conserved motifs and critical residues essential for flippase function. These conserved elements are likely to be functionally significant in P. mirabilis ArnE as well:

Key Conserved Motifs:

  • RYA Motif (position ~42-44): Contains a critical tyrosine residue that is absolutely required for function

  • YFEKP Motif (position ~66-70): Contains a critical lysine residue essential for activity

  • Charged Periplasmic Residues: Several conserved arginine and glutamic acid residues in periplasmic loops are crucial for function

Critical Functional Residues:
Based on homology with characterized ArnE proteins, the following residues are predicted to be essential:

Residue Position*Amino AcidProposed FunctionConservation
~43Tyrosine (Y)Substrate recognitionHighly conserved across species
~69Lysine (K)Electrostatic interaction with substrateHighly conserved across species
~254Arginine (R)Membrane interaction/substrate bindingConserved in Enterobacteriaceae
~493Glutamic Acid (E)Catalytic activityHighly conserved across species

*Note: Exact positions may vary slightly in P. mirabilis ArnE compared to homologs

Experimental Validation Methods:

  • Site-directed mutagenesis:

    • Create alanine substitutions at each conserved position

    • Express mutant proteins in arnE-deficient strains

    • Assess restoration of polymyxin resistance

  • Biochemical characterization:

    • Purify mutant proteins and assess binding to lipid substrates

    • Measure flippase activity in reconstituted systems

    • Analyze protein stability and membrane integration

  • Molecular dynamics simulations:

    • Model interactions between conserved residues and substrate

    • Predict conformational changes during flipping mechanism

    • Guide design of further mutations to test mechanistic hypotheses

These critical residues likely participate in either substrate recognition or the mechanical process of flipping undecaprenyl phosphate-α-L-Ara4N across the membrane. The conserved aromatic and charged amino acids may interact with the lipid portion or the L-Ara4N moiety of the substrate .

How does ArnE interact with ArnF to form a functional flippase complex?

The interaction between ArnE and ArnF to form a functional flippase complex represents a sophisticated molecular machinery for translocating undecaprenyl phosphate-α-L-Ara4N across the bacterial inner membrane. Based on available research, the following model emerges:

Structural Basis of Interaction:
The ArnE-ArnF complex likely forms a heterodimeric structure within the membrane, with both proteins contributing transmembrane domains that create a hydrophilic pathway or pore through which the polar head group of undecaprenyl phosphate-α-L-Ara4N can pass while keeping the hydrophobic undecaprenyl chain within the membrane bilayer . This arrangement would be conceptually similar to other lipid flippases, though the precise stoichiometry remains to be definitively established.

Experimental Approaches to Study the Interaction:

1. Co-expression and Co-purification:

  • Co-express ArnE and ArnF with different affinity tags (His-tag for ArnE, Strep-tag for ArnF)

  • Perform tandem affinity purification to isolate the intact complex

  • Analyze by size exclusion chromatography to determine complex formation and stability

  • Characterize stoichiometry using quantitative mass spectrometry

2. Protein-Protein Interaction Analysis:

  • Employ bacterial two-hybrid systems to map interaction domains

  • Use FRET (Förster Resonance Energy Transfer) with fluorescently labeled proteins to confirm interaction in membrane environments

  • Perform cross-linking experiments followed by mass spectrometry to identify interacting regions

3. Functional Complementation Studies:

  • Generate partial deletions or chimeric proteins between ArnE and ArnF

  • Express these constructs in strains lacking both native proteins

  • Assess restoration of polymyxin resistance to identify domains critical for functional interaction

  • Compare with individual knockout complementation experiments

4. Structural Studies:

  • Perform cryo-electron microscopy of the purified complex

  • Use computational modeling to predict interaction interfaces

  • Design mutations at predicted interfaces and test their effects on complex formation and function

Evidence from studies with homologous proteins suggests that neither ArnE nor ArnF alone is sufficient for flippase activity, indicating that they function as obligate partners in the translocation process . The fact that mutations in either gene result in similar phenotypes further supports the model of a heterodimeric functional unit.

What is the mechanistic relationship between ArnE and other components of the L-Ara4N modification pathway?

The L-Ara4N modification pathway represents a complex, multi-step process requiring coordinated action of several enzymes, with ArnE playing a crucial role in the membrane translocation step. Understanding the mechanistic relationships between pathway components is essential for comprehending the complete resistance mechanism:

Complete L-Ara4N Modification Pathway:

  • Cytoplasmic Synthesis:

    • ArnA (bifunctional enzyme) converts UDP-glucose to UDP-4-keto-pentose and later performs N-formylation

    • ArnB (aminotransferase) generates UDP-β-L-Ara4N

    • ArnC (transferase) attaches L-Ara4N to undecaprenyl phosphate

    • ArnD (deformylase) removes the formyl group

  • Membrane Translocation:

    • ArnE/ArnF heterodimer flips undecaprenyl phosphate-α-L-Ara4N to the periplasmic side

  • Lipid A Modification:

    • ArnT (transferase) transfers L-Ara4N from undecaprenyl phosphate to lipid A at the periplasmic face of the inner membrane

Experimental Approaches to Study Pathway Interactions:

1. Metabolic Flux Analysis:

  • Label UDP-glucose with stable isotopes (13C)

  • Track labeled intermediates through the pathway using LC-MS/MS

  • Compare flux in wild-type versus arnE mutant strains to identify rate-limiting steps or metabolic bottlenecks

2. Protein-Protein Interaction Network:

  • Perform co-immunoprecipitation experiments with tagged ArnE

  • Identify interacting partners using mass spectrometry

  • Confirm direct interactions with purified components using surface plasmon resonance

3. Substrate Channeling Investigation:

  • Create fusion proteins between sequential pathway enzymes

  • Assess whether fusion enhances pathway efficiency

  • Use FRET to detect proximity between pathway components in vivo

4. Reconstitution of Minimal Pathway:

  • Purify recombinant ArnC, ArnE, ArnF, and ArnT

  • Reconstitute into proteoliposomes with defined composition

  • Add labeled UDP-L-Ara4N and assess production of L-Ara4N-modified lipid A

  • Use this system to identify rate-limiting steps and regulatory mechanisms

Key Insights from Research:

  • The pathway operates as a coordinated system with spatial organization at the membrane interface

  • ArnE/ArnF flippase activity is the committed step for periplasmic utilization of L-Ara4N

  • Without functional ArnE, undecaprenyl phosphate-α-L-Ara4N accumulates on the cytoplasmic face of the inner membrane

  • ArnT requires properly flipped undecaprenyl phosphate-α-L-Ara4N as its substrate

  • The essential lipid A flippase MsbA is also involved in the pathway, transporting the modified lipid A to the outer membrane

These mechanistic relationships highlight the interdependence of pathway components and the critical position of ArnE in ensuring substrate availability for downstream processing.

How does the sequence and function of ArnE vary across different bacterial pathogens?

Comparative Analysis of ArnE Across Species:

Bacterial SpeciesArnE Homology to P. mirabilis*Notable Sequence FeaturesFunctional Significance
Salmonella enterica~65-70%Similar transmembrane topology; conserved RYA and YFEKP motifsPolymyxin resistance inducible by PmrA/PmrB two-component system
Burkholderia cenocepacia~45-50%Extended C-terminal domain; additional transmembrane segmentsConstitutive expression; essential for viability
Escherichia coli~65-75%Nearly identical topology to P. mirabilis ArnERegulated by PhoP/PhoQ and PmrA/PmrB systems
Pseudomonas aeruginosa~40-45%Divergent in several transmembrane regionsAssociated with adaptive resistance to colistin
Klebsiella pneumoniae~60-65%Highly conserved catalytic residuesImportant in carbapenem-resistant strains

*Estimated percent identity based on published homologies between related species

Evolutionary Implications:

  • The core structure and function of ArnE appear to be conserved across Enterobacteriaceae

  • Greater sequence divergence is observed in more distantly related species like Burkholderia and Pseudomonas

  • Specific adaptations in transmembrane domains may reflect differences in membrane composition across species

  • Regulatory mechanisms controlling arnE expression vary significantly between species, suggesting adaptation to different environmental pressures

Research Approaches to Study Variation:

  • Phylogenetic Analysis:

    • Construct phylogenetic trees based on ArnE sequences from diverse species

    • Identify patterns of conservation and divergence

    • Correlate with ecological niches and typical antibiotic exposure

  • Functional Complementation:

    • Express ArnE homologs from different species in P. mirabilis arnE mutants

    • Assess restoration of polymyxin resistance

    • Identify species-specific functional differences

  • Structural Modeling:

    • Develop homology models of ArnE variants across species

    • Predict functional consequences of sequence variations

    • Design experiments to test structure-function hypotheses

This comparative approach provides insights into the evolution of antimicrobial peptide resistance mechanisms and may identify species-specific vulnerabilities that could be exploited for therapeutic development.

What are the implications of targeting ArnE for novel antimicrobial development?

Targeting ArnE represents a promising strategy for novel antimicrobial development, particularly against multidrug-resistant Gram-negative pathogens. The rationale and approaches for pursuing this strategy include:

Strategic Advantages of ArnE as a Drug Target:

  • Essentiality in Some Pathogens:

    • ArnE function is essential for viability in certain species like Burkholderia cenocepacia

    • Inhibition would be lethal rather than merely increasing susceptibility to other antibiotics

  • Role in Resistance to Last-Resort Antibiotics:

    • ArnE is critical for resistance to polymyxins, which are often the last treatment option for multidrug-resistant infections

    • Inhibitors could restore sensitivity to these existing antibiotics

  • Conservation Across Pathogens:

    • Sufficient conservation to allow broad-spectrum activity

    • Enough variation to potentially develop species-selective inhibitors

  • Absence in Humans:

    • No human homologs, reducing potential for direct toxicity

    • Bacterial-specific membrane protein target

Potential Drug Development Approaches:

1. Small Molecule Inhibitor Development:

  • Design competitive inhibitors of the undecaprenyl phosphate-α-L-Ara4N binding site

  • Develop allosteric inhibitors that disrupt ArnE-ArnF interaction

  • Screen for compounds that interfere with proper membrane insertion

Screening Protocol:

  • Primary screen: Polymyxin susceptibility restoration assay in resistant strains

  • Secondary screen: In vitro flippase activity assay with reconstituted proteins

  • Counter-screen: Mammalian cell toxicity to eliminate cytotoxic compounds

2. Peptide-Based Inhibitors:

  • Design peptides that mimic transmembrane interaction domains

  • Focus on disrupting heterodimer formation between ArnE and ArnF

  • Incorporate cell-penetrating sequences to ensure delivery

3. Combination Therapy Approach:

  • Develop agents that specifically synergize with polymyxins

  • Use sub-MIC levels of polymyxins with ArnE inhibitors to reduce toxicity

  • Target multiple steps in the L-Ara4N modification pathway simultaneously

Challenges and Considerations:

  • Membrane Protein Drug Development Hurdles:

    • Difficulty in establishing high-throughput screening assays

    • Challenges in achieving specificity for bacterial membranes

    • Potential for off-target effects on other membrane processes

  • Resistance Development:

    • Potential for compensatory mutations in related pathway components

    • Alternative resistance mechanisms that might emerge upon selective pressure

    • Need for resistance monitoring in clinical development

  • Delivery Challenges:

    • Ensuring inhibitor penetration through the outer membrane

    • Achieving therapeutic concentrations at the inner membrane

    • Formulation strategies for hydrophobic compounds

The clinical significance of targeting ArnE is underscored by the increasing prevalence of multidrug-resistant P. mirabilis strains producing extended-spectrum β-lactamases (ESBLs) and carbapenemases . As polymyxins remain a critical last-line defense, inhibitors of L-Ara4N modification could dramatically improve treatment options for these challenging infections.

What are the optimal conditions for biochemical characterization of recombinant ArnE protein?

Successful biochemical characterization of recombinant ArnE requires careful attention to protein stability, assay conditions, and substrate preparation. The following optimized protocols are recommended:

Protein Purification Considerations:

Buffer Composition for Maximal Stability:

  • Base buffer: 50 mM HEPES or Tris-HCl, pH 7.5-8.0

  • Salt: 150-300 mM NaCl to maintain ionic strength

  • Glycerol: 10-15% to enhance stability

  • Reducing agent: 1-5 mM DTT or 0.5-2 mM TCEP to prevent oxidation

  • Detergent: 0.03-0.05% DDM, 0.05-0.1% DM, or 0.5-1% digitonin

  • Protease inhibitors: EDTA-free cocktail to prevent degradation

Optimal Temperature Conditions:

  • Storage: -80°C for long-term; -20°C with 20% glycerol for medium-term

  • Working temperature: All experiments at 4°C when possible

  • Activity assays: 25-30°C for optimal balance between activity and stability

Substrate Preparation Methods:

1. Synthesis of Undecaprenyl Phosphate-α-L-Ara4N:

  • Chemical synthesis approach using protected L-arabinose derivatives

  • Enzymatic synthesis using purified ArnA, ArnB, ArnC, and ArnD with UDP-glucose as starting material

  • Extraction from bacterial membranes of strains overexpressing the arn operon but lacking arnE/arnF

2. Fluorescent Substrate Analogs:

  • NBD-labeled analogs for fluorescence-based assays

  • BODIPY-labeled derivatives for enhanced sensitivity

  • Radiolabeled substrates for quantitative binding studies

Biochemical Assay Optimization:

1. ArnE-Substrate Binding Assays:

  • Microscale thermophoresis (MST) with fluorescently labeled substrate

  • Surface plasmon resonance (SPR) with immobilized protein

  • Isothermal titration calorimetry (ITC) for direct measurement of binding constants

  • Optimal detergent concentration: 2× CMC to maintain protein solubility without interfering with binding

2. ArnE-ArnF Interaction Analysis:

  • Blue native PAGE to assess complex formation

  • Analytical ultracentrifugation to determine stoichiometry

  • Chemical cross-linking combined with mass spectrometry

  • Recommended cross-linkers: DSS, BS3, or glutaraldehyde at 0.5-2 mM

3. ATPase Activity Assessment:

  • Though not required for function, test for potential ATP dependence

  • Standard malachite green phosphate release assay

  • Controls: P-glycoprotein as positive control, boiled protein as negative control

Data Analysis Recommendations:

  • Apply appropriate correction for background signal from detergent micelles

  • Use multiple protein:lipid ratios to establish dose-dependency

  • Compare results across different detergent systems to confirm consistency

  • Normalize activity to protein amount determined by quantitative amino acid analysis

These optimized conditions have been derived from successful characterization of related membrane proteins and adapted for the specific challenges of ArnE biochemistry.

How can researchers design conclusive experiments to determine if ArnE flippase activity is energy-dependent?

Determining whether ArnE flippase activity requires energy input is a fundamental question with significant implications for understanding its mechanism. The following experimental design provides a comprehensive approach to addressing this question:

Comprehensive Experimental Framework:

1. ATP Dependence Assays:

Protocol A: ATP Depletion and Reconstitution

  • Preparation of membrane vesicles or proteoliposomes containing purified ArnE-ArnF complex

  • ATP depletion using apyrase or hexokinase/glucose system

  • Assessment of flippase activity using the membrane-impermeable labeling assay

  • Reconstitution of activity by ATP addition at various concentrations (0.1-10 mM)

  • Controls: Non-hydrolyzable ATP analogs (AMP-PNP, ATP-γ-S) to distinguish between ATP binding and hydrolysis requirements

Protocol B: Direct ATP Hydrolysis Measurement

  • Purified ArnE-ArnF complex in detergent or reconstituted in proteoliposomes

  • Measurement of ATP hydrolysis using:

    • Malachite green phosphate release assay

    • Coupled enzyme assay (pyruvate kinase/lactate dehydrogenase)

    • [γ-32P]ATP hydrolysis assay

  • Correlation of ATP hydrolysis rates with flippase activity across conditions

2. Membrane Potential Dependence:

Protocol A: Ionophore Experiments

  • Preparation of membrane vesicles or proteoliposomes with reconstituted ArnE-ArnF

  • Dissipation of membrane potential using ionophores:

    • Valinomycin (K+ ionophore)

    • CCCP (proton ionophore)

    • Nigericin (K+/H+ exchanger)

  • Measurement of flippase activity before and after ionophore treatment

  • Controls: Ionophores with different mechanisms to distinguish specific effects

Protocol B: Direct Membrane Potential Manipulation

  • Creation of artificial membrane potential in proteoliposomes through:

    • K+ gradient with valinomycin

    • pH gradient with acid-base transitions

  • Correlation of measured membrane potential (using potential-sensitive dyes like DiSC3(5)) with flippase activity

3. Proton Gradient Dependence:

Protocol A: pH Gradient Experiments

  • Preparation of proteoliposomes with different internal/external pH values

  • Systematic variation of ΔpH across physiologically relevant range (pH 5.5-8.5)

  • Measurement of flippase activity as a function of ΔpH

  • Controls: Collapse of gradient using nigericin or acid/base addition

Protocol B: Site-Directed Mutagenesis of Potential Proton Transfer Residues

  • Identification of conserved charged residues in transmembrane domains

  • Generation of alanine substitution mutants

  • Assessment of proton transport capability and correlation with flippase activity

  • Complementation assays in bacterial strains to confirm functional significance

4. Definitive Mechanistic Classification:

Comparative Analysis Framework:

  • Construct a decision matrix based on results from the above experiments

  • Compare pattern of results with known mechanisms of established transporters:

    • Primary active transporters (ATP-dependent)

    • Secondary active transporters (proton gradient-dependent)

    • Facilitators (energy-independent)

  • Use inhibitor profiles, energy coupling stoichiometry, and mutagenesis results for classification

Data Integration Table:

Energy SourcePositive Result PatternNegative Result PatternInterpretation
ATPActivity correlates with ATP levels; inhibited by non-hydrolyzable analogsActivity persists with ATP depletionATP-dependent primary active transport
Membrane PotentialActivity abolished by ionophores; dependent on voltage magnitudeActivity persists with collapsed potentialElectrogenic transport
Proton GradientActivity follows ΔpH; abolished by proton ionophoresActivity independent of ΔpHProton-coupled secondary transport
None (Facilitated)Activity persists in all energy depletion conditionsN/AEnergy-independent facilitated diffusion

These comprehensive experiments would provide conclusive evidence regarding the energy dependence of ArnE flippase activity and establish its mechanistic classification among membrane transport proteins.

What are the most promising approaches for structural determination of P. mirabilis ArnE?

1. Cryo-Electron Microscopy (Cryo-EM):

  • Currently the most promising approach for membrane protein structure determination

  • Advantages:

    • Doesn't require crystallization

    • Can capture different conformational states

    • Works with smaller amounts of protein

    • Recent advances allow near-atomic resolution

  • Protocol adaptations for ArnE:

    • Express with fusion partners (e.g., BRIL, rubredoxin) to increase molecular mass

    • Use nanodiscs or amphipols instead of detergent micelles

    • Consider co-expression with ArnF to capture the functional complex

    • Apply focused refinement techniques to enhance resolution of transmembrane regions

2. X-ray Crystallography:

  • Traditional gold standard for high-resolution protein structures

  • Strategies to enhance crystallization:

    • Lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

    • Antibody fragment co-crystallization to provide crystal contacts

    • Thermostabilizing mutations to improve conformational homogeneity

    • Surface entropy reduction to enhance crystal packing

    • Truncation of disordered regions identified by hydrogen-deuterium exchange

3. Integrative Structural Biology Approaches:

4. Advanced NMR Techniques:

  • Solid-state NMR specifically developed for membrane proteins

  • Selective isotopic labeling strategies:

    • 13C/15N labeling of specific amino acids

    • Segmental labeling of domains

    • Methyl-TROSY for detecting dynamics in large proteins

  • Magic angle spinning (MAS) NMR to enhance resolution

5. Emerging Technologies:

  • MicroED (microcrystal electron diffraction) for structure determination from nanocrystals

  • Serial femtosecond crystallography at X-ray free electron lasers (XFELs)

  • AlphaFold2 and RoseTTAFold predictions as starting models, validated and refined with experimental data

Practical Implementation Strategy:

  • Begin with AlphaFold2 prediction to guide experimental design

  • Optimize expression and purification to obtain milligram quantities of stable protein

  • Perform small-scale screening across multiple approaches simultaneously

  • Focus resources on most promising methods based on preliminary results

  • Validate final structures with functional assays and mutagenesis

How might we develop high-throughput screening methods to identify inhibitors of ArnE function?

Developing high-throughput screening (HTS) methods for ArnE inhibitors requires innovative approaches that overcome the challenges associated with membrane protein targets. The following comprehensive screening strategy addresses these challenges:

1. Cell-Based Primary Screening Approaches:

Polymyxin Sensitization Assay:

  • Engineer P. mirabilis strain with fluorescent reporter linked to cell death

  • Grow in 384-well plates with sub-lethal polymyxin concentration

  • Add compound library and measure fluorescence change

  • Expected hit profile: Compounds that enhance polymyxin sensitivity

  • Z' factor optimization: Use known pathway inhibitors as positive controls

  • Throughput: ~50,000-100,000 compounds per day

Bacterial Three-Hybrid System:

  • Engineer split reporter system dependent on functional ArnE-ArnF interaction

  • Screen for compounds that disrupt protein-protein interaction

  • Miniaturize to 1536-well format for ultra-HTS capability

  • Advantage: Can identify inhibitors that act through multiple mechanisms

  • Throughput: ~100,000-250,000 compounds per day

2. Biochemical Screening Approaches:

Fluorescence-Based Flippase Assay:

  • Reconstitute ArnE-ArnF in proteoliposomes with fluorescent substrate

  • Monitor substrate translocation through fluorescence changes

  • Adapt to 384-well format with automated liquid handling

  • Challenge: Maintaining membrane protein activity during screening

  • Solution: Optimize detergent/lipid composition and use fresh protein preparations

  • Throughput: ~10,000-20,000 compounds per day

Liposome-Based FRET Assay:

  • Generate donor-labeled undecaprenyl phosphate-α-L-Ara4N and acceptor-labeled lipid A

  • Monitor FRET signal change upon substrate flipping and transfer

  • Screen for compounds that disrupt FRET signal

  • Advantage: Functional readout of complete pathway

  • Throughput: ~5,000-10,000 compounds per day

3. Fragment-Based Screening Approaches:

Thermal Shift Assay (TSA) for Membrane Proteins:

  • Monitor thermostability of purified ArnE using CPM fluorescent dye

  • Identify fragments that alter thermal stability

  • Advantage: Requires minimal protein amount

  • Challenge: Distinguishing stabilizers from inhibitors

  • Solution: Secondary functional assays for hits

  • Throughput: ~1,000-2,000 fragments per day

Surface Plasmon Resonance (SPR):

  • Immobilize purified ArnE on sensor chip

  • Screen fragment library for direct binding

  • Determine binding kinetics for hits

  • Advantage: Provides binding affinity data

  • Challenge: Potential nonspecific membrane interactions

  • Solution: Include detergent controls and reference surfaces

  • Throughput: ~500-1,000 fragments per day

4. Virtual Screening and Computational Methods:

Structure-Based Virtual Screening:

  • Use homology models or experimental structures of ArnE

  • Dock compound libraries to predicted binding sites

  • Prioritize compounds based on docking scores and interactions

  • Advantage: Can screen millions of compounds rapidly

  • Challenge: Accuracy limited by model quality

  • Solution: Experimental validation of top candidates

ML-Based Predictive Models:

  • Train machine learning algorithms on known membrane protein inhibitors

  • Apply to virtual compound libraries to identify potential hits

  • Combine with pharmacophore modeling and QSAR

  • Advantage: Can identify non-obvious chemical scaffolds

  • Throughput: Millions of compounds in silico

5. Cascade Screening Strategy:

Tiered Approach for Maximum Efficiency:

  • Primary screen: Cell-based polymyxin sensitization assay (highest throughput)

  • Secondary screen: Biochemical flippase activity assay (confirm target engagement)

  • Tertiary screen: ADME/Tox profiling (eliminate compounds with poor properties)

  • Lead characterization: Detailed mechanistic studies and structure-activity relationships

Hit Confirmation and Validation:

  • Dose-response curves in multiple assay formats

  • Counter-screens against related proteins to determine selectivity

  • Resistance selection to confirm mechanism of action

  • Synergy testing with clinical antibiotics

This comprehensive screening strategy combines the strengths of multiple approaches while addressing the specific challenges of targeting the ArnE membrane protein, maximizing the chances of identifying novel inhibitors with therapeutic potential against multidrug-resistant P. mirabilis infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.